KEGG   Agrobacterium radiobacter: Arad_8706Help
Entry
Arad_8706         CDS       T00850                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC transporter
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
ara  Agrobacterium radiobacter
Pathway
ara00910  Nitrogen metabolism
ara02010  ABC transporters
Module
ara_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Arad_8706 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arad_8706 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_8706 (nrtB)
Transporters [BR:ara02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Arad_8706 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACM29913
UniProt: B9JJ21
LinkDB All DBs
Position
2:complement(1486823..1487716)
Genome map
AA seq 297 aa AA seqDB search
MSATARKQEVIATAAPQDESRVVKLSARPVRRIDVKLIALAILRAVVPPLVVLIILLGVW
QLLCEQPGASLPPPSQVWQESYDLIAYPFFYNGPQDIGLAWRVLISLQRVAYGFGLAAIA
GVLIGALIGQSIWAMRGLDPIFQILRTVPPLAWLPLSLAAFQNSSPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVARVLRLNQIEFFFRIMVPAAAPYIFTGLRIGIGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALTYIGITGFILDKLVAAIGAFVTRGATAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaacagcccgcaaacaggaagtcatcgcgacggccgcacctcaagacgaaagc
cgcgtcgtgaaactctccgctcgtcccgttcgccgcattgatgtcaagctcatcgcactg
gcaatcctgcgtgccgtcgtgccgccgctggtggtgctcatcatcctgctcggcgtctgg
cagctcctctgtgagcagcccggcgccagtctgccgccgccgtcccaggtctggcaggag
agctacgatctcatcgcctatcccttcttctataacggtccccaggatatcggcctggcc
tggcgcgtgctcatttccctgcagcgcgtcgcctatggcttcggtcttgccgccattgcc
ggcgtcttgatcggcgcgttgatcggacagtcgatctgggcgatgcgtggcctcgatccg
attttccagatcctgcgcaccgtgccgccgctcgcctggttgccactgtcgcttgccgcc
ttccagaactcgagcccatcggcgatcttcgtgatcttcatcacctcgatctggccggtg
atcatcaacaccgccgtcggtgtgcgcaacattccgcaggattaccgcaatgtcgccagg
gtgctacggctgaaccagatcgagttcttcttccgcatcatggtgcccgctgccgcaccc
tatatctttacgggcctgcgcatcggcatcggcctgtcctggcttgccatcgtcgcggcc
gaaatgctgacgggcggcgtcggcatcggcttcttcatctgggatgcatggaactcttcg
cgcctgcccgacatcatcgtcgccctcacctatatcggcatcaccggtttcatcctcgac
aagctggtcgccgcgatcggcgcctttgtcacccgcggcgccacggccaattaa

DBGET integrated database retrieval system