KEGG   Arachidicoccus sp. BS20: A9P82_02540Help
Entry
A9P82_02540       CDS       T04406                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
arb  Arachidicoccus sp. BS20
Brite
KEGG Orthology (KO) [BR:arb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:arb02000]
    A9P82_02540
Transporters [BR:arb02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    A9P82_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 AAA_29 RsgA_GTPase AAA_27 SbcCD_C DUF3584 AAA_30 AAA_16
Motif
Other DBs
NCBI-ProteinID: ANI88279
UniProt: A0A191THU1
LinkDB All DBs
Position
complement(545050..545982)
Genome map
AA seq 310 aa AA seqDB search
MAILELQHLKKYYDTHKAVDDISFKIEEGNIFGLLGPNGAGKTTLLRMVTGIFFPDEGEV
MLDGKKFDALNDIQKIGYMPEERGLYKKMKIGEHALYLAQLKGLSRNDAMQKIKYWFERL
DMQSWWNKKVEDLSKGMGQKLQFVATVLHEPKLIILDEPFSGLDPVNANLIKDEIYNLAQ
NGSTIIFSTHRMEQVEEICDNIVLINLGKKILDGSVNEIKQNYKQHLYNLQIDGNIDDAG
VTDIFDIQHKDKNGIVLKIKDGCKSNDVLKYFIDKNIQVEHFSEILPSLNDIFIRLVHGT
NAVTRSFQNN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctatacttgaattgcaacatctgaaaaaatattatgacacacataaagcggtggac
gatatcagctttaaaattgaagaagggaacatttttggtttgctcggtcccaacggcgca
ggcaaaaccactttgctgcgtatggttacaggaattttctttcccgatgaaggcgaagtg
atgcttgacgggaaaaaatttgatgcactcaacgacattcagaaaataggctatatgccc
gaagaacgaggcttgtacaagaaaatgaaaattggcgaacatgcgctgtacctcgcacag
ttaaagggtttaagccggaacgatgctatgcagaaaatcaaatactggtttgaacgcttg
gatatgcaaagctggtggaacaaaaaagttgaagacctgagcaaaggtatggggcaaaaa
ttacaatttgttgctaccgttttgcatgaacctaaattaatcattcttgacgagccgttc
agtggtcttgaccctgtaaatgccaatttaattaaagacgaaatttacaatcttgcccaa
aatggaagcactataattttctcgacgcaccgtatggagcaagtggaagaaatttgcgat
aatattgttctaatcaatcttggcaaaaaaatattggacggcagcgtaaacgaaataaaa
caaaactacaagcaacatttatacaatcttcaaatcgatggaaacattgatgacgcgggc
gttacagatatttttgatattcagcataaggacaaaaacggaattgttttaaaaataaaa
gacggctgcaagagcaacgatgtactgaaatattttattgacaaaaatattcaggtagag
cacttcagcgaaatattgccatcgctcaacgacatttttatccggcttgtacacggcaca
aatgccgttacacgcagctttcaaaacaattaa

DBGET integrated database retrieval system