KEGG   Arachidicoccus sp. BS20: A9P82_03610Help
Entry
A9P82_03610       CDS       T04406                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb00240  Pyrimidine metabolism
arb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A9P82_03610
Enzymes [BR:arb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A9P82_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ANI88467
UniProt: A0A191TID0
LinkDB All DBs
Position
complement(783907..784482)
Genome map
AA seq 191 aa AA seqDB search
MFIEPSLKGENRGWIEVICGSMFSGKTEELIRRLKRVEIAGLKAEIFKPSIDVRYSEQAV
VSHDANEIQSTPVSSSQNILLLSQDVNVVGIDEAQFFDSEIVNVCEILARKGVRVIVAGL
DMDYKGRPFGPMPQLLAVADYITKLHAICVKCGNIASMSYRKVSQDSQVLLGEKETYEPR
CRSCYYEGENI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgttcatagaaccaagcctgaaaggcgaaaacagaggttggattgaagtgatttgcggc
tccatgttcagcggaaaaaccgaagaactgattcgcagattaaagcgcgtagaaattgca
gggctgaaagcagaaatcttcaaaccctcgattgacgtgcgttacagcgagcaagctgtt
gtgagccacgatgccaatgaaattcaaagtacgcctgtaagctcttcgcaaaatattttg
ttgctgtcgcaggatgtaaatgttgtaggtattgacgaagcacaattctttgacagcgaa
attgtaaacgtatgcgaaatactcgcccgcaaaggcgttcgcgtaattgttgccggtttg
gatatggattacaaaggtcgcccgttcggaccgatgccgcaattgctggcagtggcggat
tacattacaaaattgcacgcaatctgcgtgaagtgcggcaacattgcgagcatgtcttac
cgcaaagtgtcgcaggattcgcaagtgttattaggcgaaaaagaaacttatgaaccgcgt
tgcagaagctgttattacgaaggagagaatatttga

DBGET integrated database retrieval system