KEGG   Arachidicoccus sp. BS20: A9P82_04435Help
Entry
A9P82_04435       CDS       T04406                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb00620  Pyruvate metabolism
arb00680  Methane metabolism
arb01100  Metabolic pathways
arb01120  Microbial metabolism in diverse environments
arb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9P82_04435
  09102 Energy metabolism
   00680 Methane metabolism
    A9P82_04435
Enzymes [BR:arb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9P82_04435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Peptidase_M3_N Cytomega_gL Entericidin Arc_PepC_II
Motif
Other DBs
NCBI-ProteinID: ANI88601
UniProt: A0A191TIS9
LinkDB All DBs
Position
complement(979228..981798)
Genome map
AA seq 856 aa AA seqDB search
MQNSSLLQFRNKVGLRFQLYNSLFTSLPFHRIEKTGVWLSLFLIHCEEGYKKSQSPVELI
ETFLQQYSTYEDEREQLDMLFRFIQYIERQVVLFDALEDASFADIQDVSGQGTMKQLRAQ
TELQDKQAALAEKVKDFSVRLVLTAHPTQFYPGEVLGIINDLASALNSNNTQNINDYLVQ
LAKTPFLKKKKPTPYDEALSLIWYLENVFYQAAGKIVADLQMQFPEMLFEKNSIIRMGFW
PGGDRDGNPYVNSNTTVQVAEQLHQSILFCYYRDIRKLKRRLTFKGVGEDVEAMEKAFHA
VLLEQNKDIKITEEWLLDSLRKLRTKIIEQHNGLFVRLIDDLIGKINIFGIYFATIDIRQ
DSGVHQRLMQHLSETENGLPKNYTSLSEEEKVDVIIKIKKPANEKLLKEPVFIDTFESMK
AMKAIQKMNGEFGCNRYIISHCTSLLDVMEVYGLLKLSGWEKKEHSVDILPLFETIEDLQ
TAGEVMEKLYNNKTYRNHLQHRNNTQSIMLGFSDGTKDGGYLMANWCIYKAKEELTRISR
KYDINVVFFDGRGGPPARGGGKTHKFYASMGSNIENKEIQVTVQGQTVSSNFGTVQSAQY
NIEQLLNAGISNDVLFSKKETLTKEEETLLSQLSEEGFASYSELKEHPYFMEYLSYASPL
KFYGATNIGSRPTKRNASAKLTLNDLRAIPYVGAWSQLKQNVTGYYGVGTALQKLEKAGK
FKALKDLYKNSLFFRALIDNSEMSMKKCFFPLTQFHAKHPKYGEIWKKIYEEYLLTEKMV
LRLSGQTELMANYPVESLSIQMRERIVLPLVTIQQFGLHKYTELEQSGAKSNLKEVYEKL
IMRCSFGIINAGRNSA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacagttcactgttacaattcagaaataaagtcggtttacgttttcagttatac
aacagtttgtttacgtcgttgccttttcatcgtattgaaaagacgggtgtttggttgtct
ttatttttgattcattgcgaagaagggtataaaaaatcgcaaagcccggttgagttgatt
gagacttttttgcagcaatactcaacttatgaagatgagcgggagcagctcgatatgctg
tttcgttttatccaatatatcgagcggcaggtagtattattcgatgctttggaagatgct
tcatttgccgatattcaggatgtttcgggacagggaactatgaaacagttgcgcgcgcaa
actgaacttcaggataagcaggcagcgcttgccgaaaaggtaaaagatttttctgtgaga
cttgtgttgacggcgcatcccacgcagttctatcccggcgaagtcttgggtattatcaat
gatttggcttctgctttaaattccaataatacccaaaacatcaacgattatttggtgcag
ttggcaaaaacacctttcttaaaaaagaaaaagcctacgccttacgatgaagcgttgagt
ttgatttggtacttggaaaatgtgttttatcaggctgcgggcaaaatcgttgccgacttg
caaatgcagtttccagaaatgttgtttgagaaaaattccatcatccgtatgggcttttgg
cccggcggcgatagggacggaaacccttatgtgaacagcaatacaacggttcaggtggca
gaacaactgcatcagtctattttgttttgctattacagagatattcgcaaactcaaacgc
agattgacttttaaaggtgtgggagaagatgttgaggcaatggaaaaagcatttcatgcc
gtattgctggagcaaaataaagatataaaaattacggaagagtggctgctggattcatta
agaaaattgcggacaaaaattattgaacagcacaatggactgttcgtgagattgattgat
gatttaattgggaaaataaacattttcggaatttatttcgcaactattgacattcgtcag
gacagcggtgtacatcaaagactgatgcagcatttgagcgaaacggaaaacggtttgccc
aaaaattatacttcgctttccgaagaagaaaaagtagatgtgattataaaaatcaaaaag
cccgcaaatgaaaagctgctgaaagaacctgtttttattgatacttttgaatcgatgaaa
gccatgaaagccattcagaaaatgaacggcgaatttggctgtaaccgttacatcatcagc
cattgcacaagtttgttagatgtaatggaagtttatggtttgcttaaattaagcggctgg
gaaaagaaagagcattcggtagatattcttcctctgtttgaaacgattgaagatttgcaa
actgccggcgaagtgatggaaaaattgtacaacaacaaaacttatcgcaatcatttgcag
catcgcaataatacgcaaagcattatgcttggcttttccgatggtacaaaagacggtggt
tacctcatggctaactggtgcatttataaagcgaaagaagagcttacgcgcatttcgaga
aaatacgacattaatgtagtgttcttcgacggacgcggcggtccgccggcgcgcggtggt
ggaaaaacccataagttttatgcatcaatgggcagcaatattgagaataaagaaattcag
gtaactgtgcagggacaaactgtaagttccaattttggaacagtacaatctgcccaatac
aacatcgagcaattgttaaacgcaggcatttcaaacgatgttttattttccaaaaaagaa
acattgaccaaagaggaggaaaccttattgtctcagctttctgaagagggttttgcttcg
tacagcgagttaaaagagcatccttatttcatggaatatctttcttacgcaagtcccttg
aagttttatggtgccaccaatatcggcagtcgtccaaccaaaaggaacgcttcggcaaaa
ctcacattgaacgatttacgggctattccttacgtgggcgcatggagccagttaaaacaa
aatgtaacaggctattatggtgttggaacagctttgcaaaagctggaaaaagcgggcaaa
ttcaaggctttgaaagatttgtacaaaaattcattattcttccgtgcgctgattgataac
agtgaaatgtctatgaaaaaatgtttctttccattgacacaatttcatgcaaagcaccct
aagtacggcgagatttggaaaaagatttacgaggaatatttacttaccgaaaaaatggta
ttacgcctcagcggacaaacagaactgatggcgaattatcctgtagagtctttgtctatt
caaatgcgcgaacgtatagtactgccgcttgtaactattcagcaattcggcttgcacaaa
tacacggagcttgaacaatccggcgccaaaagcaatttaaaagaagtatatgaaaagctg
attatgcgttgctctttcggtatcatcaatgcaggaagaaattcggcgtaa

DBGET integrated database retrieval system