KEGG   Arachidicoccus sp. BS20: A9P82_06900Help
Entry
A9P82_06900       CDS       T04406                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb00010  Glycolysis / Gluconeogenesis
arb00020  Citrate cycle (TCA cycle)
arb00620  Pyruvate metabolism
arb01100  Metabolic pathways
arb01110  Biosynthesis of secondary metabolites
arb01120  Microbial metabolism in diverse environments
arb01130  Biosynthesis of antibiotics
arb01200  Carbon metabolism
Module
arb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9P82_06900
   00020 Citrate cycle (TCA cycle)
    A9P82_06900
   00620 Pyruvate metabolism
    A9P82_06900
Enzymes [BR:arb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A9P82_06900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ANI89043
UniProt: A0A191TK10
LinkDB All DBs
Position
1527747..1529378
Genome map
AA seq 543 aa AA seqDB search
MAEVIKMPRLSDTMTEGVIAAWHKKVGDDVKKGDLLAEIETDKATMELESYKDGTILYLG
ADNGGKLQVDDLLAIVGNKGEDISALVSGGATAPAKTEEAKPAETPAATASQPSSSIDIS
KLDEVVLMPRLSDTMTEGVIASWQKNVGDDVKKGDILAEIETDKATMELESYKNGKLLYQ
GAPAGEKIAVNDLLAIIGSDGIDVNAIVAAAKSNTSASEAEPAKEEAQTVEKSAAPAATP
APQAEQVVVNEGRILASPLAKKLASEKGIDLKYVKGSGDNGRIVKADVENYTPSAQTQAA
PASANVETFATAAPAGQVSFDEIPVTQMRKTIARRLSESLFTAPHFYVTMSINMDAAVAA
RPVLNKDGKAKISFNDIVLKAVAVALKQHPAVNSSWLGDKIRINHHVNIGVAVAVEDGLL
VPVVRFADTKSLTQISAEVKTFAQKAKDKKLQPSDWEGSTFTISNLGMFGVDEFTAIINP
PDACILAVGGISQEPIVKDGQIVVGNIMKVTLSADHRVVDGATAAAFLQTLKGLLEEPLK
MLL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattaaaatgccgcgtttaagcgatacgatgaccgaaggtgtgattgcc
gcatggcacaaaaaagtgggcgacgatgtgaagaaaggcgatttgttggcagaaattgag
accgacaaagcaacaatggaactcgaaagttacaaagatggaacgattctctatctcggc
gcagacaacggcggcaaattgcaggtagatgatttgctcgcaatcgttggtaataaaggc
gaagatattagcgcattggtttccggcggcgcaactgctcctgcaaaaaccgaagaagca
aaacctgctgaaacacctgctgcgactgcatctcagccaagttcatctatcgatatttcc
aaattggacgaagtagttttgatgcctcgcctgagcgatacaatgacggaaggcgtaatc
gcttcctggcaaaaaaatgtgggcgatgatgtgaagaaaggcgatattcttgccgaaatc
gaaaccgacaaggcaacgatggaattggaaagttataaaaacgggaaactgctttatcaa
ggtgcgcctgccggcgaaaaaattgcggtaaatgatttactcgcaatcatcggcagcgat
ggaattgatgtaaacgcgattgttgccgcagcaaaaagtaacacttccgcaagcgaagcg
gagcctgctaaagaagaagctcaaactgttgaaaaatctgctgcgcctgccgcaacgcct
gcgccgcaagcggaacaggttgtggtaaacgaaggaagaattttggcttcgcctttggct
aaaaaattggcaagcgaaaaaggcatcgatttaaaatatgtaaaaggcagcggcgacaac
ggaagaatcgtaaaagccgatgtggagaattatacgccaagtgcacaaacgcaagctgca
cctgcatctgcgaacgttgaaacctttgcaactgccgcgcctgcgggacaagtttctttc
gacgaaattcctgttacacaaatgcgcaaaaccattgcgcgccgattgtcggaaagttta
tttaccgcgccacatttttatgttaccatgtctatcaacatggatgctgcggttgccgcg
cgtcccgtgttgaataaagacggcaaagcaaaaatcagctttaacgatattgtgttgaaa
gcggttgccgttgcgttgaaacaacatcctgccgtgaacagcagttggctgggcgataaa
atccgcatcaatcatcatgtgaacattggcgttgcagttgcggtggaagacggattgctt
gtgcctgttgttcgcttcgcagatacaaaatcattgacacaaatttctgcggaagtaaaa
actttcgcacagaaagcaaaggataaaaaattgcagccgtccgattgggaaggcagtaca
ttcacgattagcaatttgggaatgttcggcgttgatgaatttacggcaatcatcaatccg
cccgatgcgtgtattcttgcggttggcggcatttcgcaagaaccgattgtgaaagacggg
caaattgtggtgggcaacattatgaaagttacgttgagcgcagaccatcgcgtggtggac
ggcgcaacggcagccgcattcctgcaaacgctgaaaggcttgctggaagagcctttgaag
atgttgttgtaa

DBGET integrated database retrieval system