KEGG   Arachidicoccus sp. BS20: A9P82_08330Help
Entry
A9P82_08330       CDS       T04406                                 

Definition
(GenBank) restriction endonuclease
Organism
arb  Arachidicoccus sp. BS20
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII TelA DUF2135
Motif
Other DBs
NCBI-ProteinID: ANI89296
UniProt: A0A191TKS0
LinkDB All DBs
Position
1852314..1853156
Genome map
AA seq 280 aa AA seqDB search
MSEQFKIFLSQLSETNATLDYFTDFKKIKSNVNKIAIKLNQLNYLIGKENLKEAVNELYE
ENPKVFEVLDILIAIRKNKNAKTFNNKGEIVLLDTYFTSPELILEYIEETGLAEIFRNKD
VTNLVDYVFGIEVGLDTNARKNRGGDNMSKAVSLIFDKAGVFYKKEVNNTIFPEIISLGA
DVKRFDFVIKTKKKTYLIETNYYNGGGSKLNETARAYSDVAPKINQYKNYEFVWITDGQG
WFSAKNKLEEAYNIIPSLYNLTTLEDFIKKIQEEQIISEW
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaatttaaaatcttcttatcgcaactttcggaaactaatgcaacgcttgat
tatttcacggatttcaagaaaataaaaagcaacgtaaacaaaattgcaatcaaactcaat
cagttaaattacctgattggaaaagagaatttgaaagaagccgtaaatgagctttatgaa
gaaaatccgaaagtctttgaagttttggacatcttgattgctattcgtaaaaataaaaac
gccaagacattcaacaacaaaggcgaaattgttttgttggacacttatttcacttcgcct
gaactgattttggaatacatcgaagaaacaggtttggcagaaatttttagaaataaagat
gttaccaatttagttgattatgtttttggaattgaggttggtttagatacaaatgcaaga
aaaaacagaggtggcgacaatatgtcaaaagccgtttcacttattttcgacaaagcagga
gttttctataaaaaggaagttaacaatacgatatttccagaaattatcagtttgggagca
gatgtaaaacgttttgattttgtcatcaaaaccaaaaagaaaacgtatctgattgaaacc
aattattacaatggtggtggttcaaaactgaatgaaactgcaagagcctattctgatgtt
gcgccgaaaataaatcaatacaaaaactacgaatttgtttggataacagacggacaaggt
tggttttcagcaaagaacaaattggaagaagcgtacaacatcataccaagtttgtataac
ttgacaacgcttgaagattttatcaagaaaattcaagaagaacaaataattagcgaatgg
taa

DBGET integrated database retrieval system