KEGG   Arachidicoccus sp. BS20: A9P82_12515Help
Entry
A9P82_12515       CDS       T04406                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb01100  Metabolic pathways
arb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9P82_12515
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A9P82_12515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arb01011]
    A9P82_12515
Enzymes [BR:arb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A9P82_12515
Peptidoglycan biosynthesis and degradation proteins [BR:arb01011]
 Precursor biosynthesis
  Racemase
   A9P82_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ANI90032
UniProt: A0A191TMV0
LinkDB All DBs
Position
complement(2857633..2860083)
Genome map
AA seq 816 aa AA seqDB search
MYPIQSISEIIEAESLFADKEIKIEHLITDSRRITFAASSLFFAIKTEHRNGADFVEEAY
RQGIRNFVLQENIDTGKYKDANFLFVKNTLASLQKLAAFHRLQFHYPVIGITGSNGKTIV
KEWLNFLLNDDYKIIRSPRSYNSQIGVPLSVWEMGEEDNLGIFEAGISEVNKMENLEKII
QPEIGIFTNLGDAHEKGFTSKQQKLEEKIKLFQHSKIVFANADDEQIISTLKKKTSAQIL
SYGKNQQATLKIIDIKKEQRQTTVVADYQAKEISITIPFIDDASLQNACVCWLAAIYLNI
DEKIIQQKMLQLPVIDMRLQVLPAINNCTIINDSYSLDIDSLSVGLDLLNQQLLSKTLIL
SDFHNDDERIYQSAINILVNKKINRLIIIGKNWQQYQTELKNKIAAVETYSTSNDFINHF
QPNHFKNEAILLKGARCFHFEELLNLLIQKVHQTRLEINLSNIVHNLKEYRKHLKPTTKV
MAMVKAFAYGSGSIEIASILQYHKIDYLTVAYADEGVELRNAGINIPIMVMNTDEYGFET
IVQHNLEPEIYSFKILNEFAVFLQKQGVAQFPVHLKIDTGMHRLGFEESQMDDLIAGLKA
NKSLVIKSVFSHLVGSEDAAEDDFTKKQTDIFIRCCAQIENALQYKFIRHISNSAAIIRH
PEIQFDMVRLGIGLYGVNYTPEKMDLKVVASLKTTIAQIKHEQPGDSVGYNQKGKINKPT
TTATIRIGYADGYNRRFSNGAGFVLINNQPAKVIGNVAMDMTMVDITDIPNVKEGDDVEV
FGENLPVQKLAKQSGTIAYEIFTSVGQRVKRVYVEE
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaatccaatcaataagcgaaataatcgaagcggaaagtcttttcgccgataaa
gaaattaagatagaacacttaattacggacagccgcaggattacttttgcggcttcgtca
ttgttctttgcgataaagacggaacacaggaacggcgcggatttcgtcgaagaagcctat
cggcagggaatcagaaattttgtgttgcaggaaaatattgataccggaaaatataaggat
gcgaattttttattcgtgaaaaatacgcttgcttctttgcaaaaattggcggcgtttcat
aggttgcaatttcattatcccgttatcggtattacgggcagcaacggcaaaacgattgtg
aaagaatggttgaattttttattgaatgatgattataaaatcattcgcagtccgcgcagt
tacaactcgcaaatcggtgttccgttgagcgtttgggaaatgggcgaagaagataatctc
ggcatttttgaagcaggcatttcggaagtgaataagatggaaaatcttgaaaaaatcatt
cagccggaaataggaatctttaccaatctcggcgatgcgcacgaaaaaggctttacaagt
aagcaacaaaaactggaggaaaaaataaagctattccaacattcaaaaattgtttttgcc
aatgcagatgatgaacaaattatttcaacactaaagaaaaaaacttccgcgcaaatattg
tcttacggaaaaaaccaacaggcaactttaaaaattattgacataaaaaaagaacagcgg
caaacaacggttgttgctgattatcaggcaaaggaaatttcaattaccattccttttatc
gatgatgcttcccttcaaaacgcttgtgtttgctggcttgcagcaatttatttgaatatt
gatgaaaaaattatccaacaaaaaatgttgcaattacccgtgatagatatgcgtttgcaa
gtattgcccgcgataaataattgtactattatcaacgacagttacagtttggatatcgat
tcattgagtgtcggtttagatttgctcaatcaacagttgttgtctaaaacactgattcta
tctgactttcacaatgatgatgaaagaatttatcaatcggcgataaatattttagtgaat
aaaaaaattaaccgcttaattatcattggcaaaaactggcaacaatatcaaactgaattg
aaaaataaaattgccgctgttgaaacatattcaacaagtaatgatttcattaatcatttt
cagccaaatcattttaagaacgaagccattctgctgaaaggtgcacgctgctttcatttc
gaagagttgttgaatctgttgattcaaaaagtccatcagacaagattggaaattaattta
tccaatatcgttcataacttaaaagaatatcgcaagcatctcaaaccgacgaccaaagta
atggcgatggtcaaagcatttgcttacggcagcgggagtattgaaattgcgagcattttg
cagtaccacaaaatcgattatctcacggtagcttatgccgatgaaggcgttgaattgcgc
aacgcgggaatcaacattccgataatggttatgaacaccgatgaatatggttttgaaacg
attgttcaacacaatttagaacccgaaatttattcgttcaaaatactgaacgagtttgcg
gtatttctccaaaagcaaggcgtggcgcagtttcccgttcatttaaagattgatacaggc
atgcaccgtttgggttttgaagaaagtcagatggatgatttaattgctgggttgaaagct
aataagtcattggtcattaagtcagttttcagtcatttggtaggaagcgaagacgcggct
gaagacgattttacaaaaaagcaaaccgatatttttattcgctgttgcgctcaaattgaa
aatgctttgcaatacaaattcatccgtcatatctcaaattccgcagcaatcatccgtcat
cctgaaatacaatttgatatggttcgtttgggaattggtttgtatggcgtgaattatacg
cccgaaaaaatggacttaaaagtcgttgcttcattgaagacaaccattgcgcaaattaag
catgagcaacccggtgattcggtcggttataaccaaaaagggaaaattaataaacctaca
acaaccgcaacaattcgtatcggttatgcagatggttacaaccgaagattcagcaatggt
gcgggtttcgtattaatcaataatcagcctgctaaagttatcggcaatgtggcgatggat
atgacaatggtggacataacggatattccaaatgtgaaagaaggcgacgatgtagaagtg
tttggcgaaaatcttcctgttcaaaaacttgccaagcaaagcggaacaattgcttatgaa
atttttacatccgttgggcaaagagtgaaaagggtttatgtggaagaatga

DBGET integrated database retrieval system