KEGG   Arcobacter sp. L: ABLL_0137Help
Entry
ABLL_0137         CDS       T01834                                 

Definition
(GenBank) fumarate reductase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
arc  Arcobacter sp. L
Pathway
arc00020  Citrate cycle (TCA cycle)
arc00190  Oxidative phosphorylation
arc00650  Butanoate metabolism
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
arc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABLL_0137
   00650 Butanoate metabolism
    ABLL_0137
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ABLL_0137
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ABLL_0137
    1.3.5.4  fumarate reductase (quinol)
     ABLL_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like DAO GIDA AlaDh_PNT_C FAD_oxidored Thi4 Pyr_redox_3 FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAK72012
UniProt: G2HRP6
LinkDB All DBs
Position
complement(123299..124900)
Genome map
AA seq 533 aa AA seqDB search
MIDVLVIGAGGAGLTAAINAKESNSNVLIISKTHPTYSQTVQAQGGINAVLYENNDSISK
HIEDTYQGSYKLSIKDNIEYICKEAKNSILWLDSIGVPFNRDSNDNFSQRKFGGTKNIRT
CYSSDYTGLKIIHTLYDQCIKNDIDFLCDYFLLDLIIEDNICKGGIFLDISSGEVKEILS
KTTILATGGYAGIYKNNTTNSYSNSGDGIAVALRAGVKLSNMEFIQFHPTTLLDTNILIS
ESARGEGGYLVDQNKIRFVNELGSRDEVTNAIYKKIQKGDKVFLDLRHLGLNKIKELIPQ
ERNLAYLFSNIRIENELLPIIPAAHYSMGGIKTDLHTKTNIDNLYACGECSQASIHGANR
LGGNSLLEIITFGKLAGLNASKKAKEIKSFNTNQTHLEINTKLINDIFNYPNKIDFYENK
EIFSNEIFSKLGIFKTEKSINDFIEILDEQLSILNQMGIGDKSKYYNTNLVEFLEFINIL
QISKVIALNAKNRKESRGSHNRLDYKESLKSYEKFSYTYFKNSKLEIGFEDIQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgttttagttataggagcaggtggagcaggtttaacggcagctattaatgct
aaagaatcaaattctaacgtattaattatttcaaaaactcatccaacatactcacaaaca
gttcaagcacaaggtggtataaacgcagtcttatatgagaataatgatagcatttcaaaa
catattgaagacacttatcaaggctcttataaactctctataaaagataatattgaatat
atctgtaaagaagcaaaaaattctattttatggttagattccataggtgtgccatttaat
agagatagcaatgacaacttttcacaaagaaaatttggtggaacaaaaaatattagaact
tgttactcaagtgactatactggcttaaaaattattcatacattatatgatcaatgcata
aaaaatgatatagattttttatgtgattattttttacttgatttgattattgaagataat
atttgcaaagggggaatatttttagatatttcttctggtgaagtaaaagaaattctttca
aaaacaacaattttagctacaggtggttatgctggtatatataaaaacaatacaacaaat
tcatactcaaatagtggagatggaattgctgtggcattaagagcaggagtaaaactatct
aatatggaatttatacaatttcatccaacaactttattagatacaaatatactaataagt
gaaagtgcaaggggtgagggtggatatttagttgatcaaaataaaattagatttgttaat
gaattaggatcaagagatgaagtaacaaatgcaatatataaaaaaatacaaaaaggtgat
aaagtttttttagacttaagacatttaggattaaataaaataaaagaattaatccctcaa
gaacgaaatttggcttatcttttttcaaatattagaattgaaaatgaattattacccatt
attccagcagctcattacagtatgggaggaataaaaactgatttacatacaaaaactaac
atagataatttatatgcttgtggagaatgctctcaagcgtctatacacggtgcaaataga
ttaggaggaaattctctattagagattattacttttggcaaattagcaggtttaaatgct
tcaaaaaaggcaaaagaaatcaaatcttttaatacaaatcaaactcatttagaaataaat
actaaattaataaatgatattttcaattatccaaataaaatcgatttttatgagaataaa
gagattttttctaacgaaatattctctaagttgggtatctttaaaacagaaaaatctatc
aacgattttattgaaatcttagatgaacaattatcaattttaaatcaaatgggaataggt
gataaatcaaaatattataatacaaatttagttgaatttctagaatttataaacatacta
caaatatcaaaagttattgcattaaatgctaaaaatagaaaagaaagtaggggaagccat
aatcgattggattataaagagagtttaaaatcatatgaaaaattttcatatacttatttt
aaaaattctaaattagaaataggttttgaggatatacaatga

DBGET integrated database retrieval system