KEGG   Arcobacter sp. L: ABLL_0359Help
Entry
ABLL_0359         CDS       T01834                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
arc  Arcobacter sp. L
Pathway
arc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01130  Biosynthesis of antibiotics
arc01230  Biosynthesis of amino acids
arc02024  Quorum sensing
Module
arc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:arc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABLL_0359
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ABLL_0359
Enzymes [BR:arc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ABLL_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: BAK72234
UniProt: G2HSS3
LinkDB All DBs
Position
342876..344237
Genome map
AA seq 453 aa AA seqDB search
MNIWTPNSWRDFPIKQQPTYNDLEKLAKVESELASYPPLIFAGEALNLKKQLADVVNGKA
FLLQGGDCAESFTSFNAANIKDLFKVMMQMAVVLTFSGGCPVVKVGRVAGQFAKPRSADF
EEIEGVSLPSYRGDIVNDIAFTEKARNPRAKKLLKAYNQSAATMNLLRAFSRGGMADLNQ
VHIWNLDFVKDNYLGAKYEELANKISESLTFMKACGITSENTPQLNQTTLFTSHEALLLN
YEQALTRKDSITGDWFNCAAHMLWIGDRTRDLKDAHIEYFRGIKNPIGCKVGPTMKEDEL
IQLIDTLNPTNEAGRLNLIVRMGANKVGDFFPKLLQRVKAEGKNVLWSSDPMHGNTIKAD
NGYKTRDFEAILSEVKQFFQIHKAEGTYAGGIHLEMTGQNVTECTGSASSAVTQESLSSR
YHTQCDPRLNADQALELSFMIADTLKEARKDLA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttggactccaaatagctggagagattttcctataaaacagcaaccaacatat
aatgatttagaaaaacttgcaaaagtagaatcagaacttgcatcttatcctcctttaatt
tttgcaggagaagcactgaatttaaaaaaacaattagctgatgttgtaaatggtaaagct
tttttacttcaaggtggagattgtgcagaatcatttacatcatttaatgctgcaaatata
aaagatttatttaaagtaatgatgcaaatggcagttgttttaactttttctggtggttgt
ccagttgtaaaagtaggacgagttgcaggtcaatttgcaaaaccaagaagtgctgatttt
gaagaaatagaaggggtaagcttgccttcatatagaggtgatattgtaaatgatattgca
tttactgaaaaagcaagaaatccaagagctaaaaaattattaaaagcatataatcaaagt
gcagcaacaatgaaccttttaagagctttttcaagaggtggaatggctgatttaaatcag
gttcatatatggaatttagattttgtaaaagataattatttaggtgcaaagtatgaagaa
cttgcaaataaaattagtgaaagtttaacatttatgaaagcttgtggaattacaagtgaa
aatactccacaattaaatcaaactacactatttacttcacatgaagcactattgttaaat
tatgagcaagcactaactagaaaagattcaatcactggtgattggtttaactgtgctgct
catatgttatggattggtgatagaacaagagatttaaaagatgctcatattgaatatttt
agaggaattaaaaatccaatcggatgtaaagtaggtccaactatgaaagaggatgaatta
attcaattaattgatactttaaatcctactaatgaagctggaagattaaatcttattgtt
agaatgggtgcaaataaagttggtgatttcttcccaaaacttttacaaagagtaaaagca
gaaggtaaaaatgtattatggtcaagtgatccaatgcatggaaatacaataaaagctgac
aatggatataaaactagagattttgaagcaattttaagtgaagtaaaacaattttttcaa
atccataaagcagaaggtacttatgcaggtggaattcatcttgaaatgacaggacaaaat
gtaacagaatgtacaggaagtgcatcttctgctgtaactcaagaaagtctatcaagtaga
tatcatactcaatgtgacccaagattaaatgctgaccaagctttagagttatcatttatg
attgctgatactttaaaagaagcaagaaaagatttagcgtaa

DBGET integrated database retrieval system