KEGG   Arcobacter sp. L: ABLL_2459Help
Entry
ABLL_2459         CDS       T01834                                 

Definition
(GenBank) phenol hydroxylase P1 subunit
  KO
K16243  phenol/toluene 2-monooxygenase (NADH) P1/A1 [EC:1.14.13.244 1.14.13.243]
Organism
arc  Arcobacter sp. L
Pathway
arc00361  Chlorocyclohexane and chlorobenzene degradation
arc00362  Benzoate degradation
arc00623  Toluene degradation
arc01100  Metabolic pathways
arc01120  Microbial metabolism in diverse environments
arc01220  Degradation of aromatic compounds
Module
arc_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:arc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABLL_2459
   00361 Chlorocyclohexane and chlorobenzene degradation
    ABLL_2459
   00623 Toluene degradation
    ABLL_2459
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     ABLL_2459
    1.14.13.244  phenol 2-monooxygenase (NADH)
     ABLL_2459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_Hydrox DUF4618
Motif
Other DBs
NCBI-ProteinID: BAK74334
UniProt: G2HYY1
LinkDB All DBs
Position
complement(2542611..2543603)
Genome map
AA seq 330 aa AA seqDB search
MELNIASVEIEPKRHTFGHVAQRLGEDRPASRYEEAMYDAQPTENFHYRPQWEPEFEIYD
KNRTKIKMNDWYDLLDPRKFHYMSYVSTRASQNAANEQSFEFVEKRGLVNFIKKDNLQKV
YDFLTPLRHYEYGANMNNLAIVDRVYGTAMMSACLFQAEDRLGMAQHITKIILLLSDNDV
SKLDAGKDAWLNCPNWQGLRKAVEDSFVEKDPIRLFVKQNVVFDAFVIPLMINEFSKELA
QNDEMTVSMLNEFIVSWYEETVKWLDSVIKVMVKESDENRDLLTTWVKEDIEIIENAMEH
LSTFSNNPKELISSVKAELIARLKSCGINL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaatatagctagtgttgaaatagaaccaaaaagacatacttttggtcatgtt
gctcaaaggttaggtgaagatagaccagcttcaagatatgaagaagctatgtatgatgca
caaccaactgaaaattttcattatagacctcaatgggagcctgaatttgaaatttatgat
aaaaatagaacaaaaatcaaaatgaatgattggtatgatttattagatcctagaaagttt
cattatatgtcttatgtatcaacaagagcttctcaaaatgcagcaaatgaacaaagtttt
gaatttgtcgagaaaagaggtttagttaattttattaaaaaagataatttacaaaaagta
tatgattttttaactccattaagacactatgagtatggtgcaaatatgaataatcttgca
attgtagatagagtttatggaacagctatgatgagtgcttgtttgtttcaggctgaagat
agacttggaatggctcaacatataacaaaaataattttattacttagtgataatgatgtt
tcaaaattagatgcaggaaaagatgcttggctaaattgccctaattggcaaggtttaaga
aaagcagttgaggattcatttgtagaaaaagatccaattagattatttgtaaagcaaaat
gttgtttttgatgcttttgtaattcctttgatgattaatgaattttcaaaagagttagcg
caaaatgatgagatgacagtttcaatgttaaatgaatttatagtttcttggtatgaagaa
acagttaaatggttagatagtgttataaaagttatggttaaagaatcagatgaaaataga
gatttattaactacttgggtaaaagaagatattgaaattatagaaaatgcaatggaacat
ttatcgacattttcaaataatcctaaagaattaatatcaagtgttaaagcagagttaata
gctagattaaaaagctgtggaataaatttataa

DBGET integrated database retrieval system