KEGG   Arcanobacterium sp. 2701: HC352_06845Help
Entry
HC352_06845       CDS       T06546                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
arca  Arcanobacterium sp. 2701
Brite
KEGG Orthology (KO) [BR:arca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HC352_06845 (ahpF)
Enzymes [BR:arca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HC352_06845 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like Glutaredoxin FAD_binding_2 NAD_binding_7 Thi4 K_oxygenase FAD_binding_3 AlaDh_PNT_C FAD_oxidored DAO NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QJC22253
LinkDB All DBs
Position
complement(1491558..1493102)
Genome map
AA seq 514 aa AA seqDB search
MFLDDNTITQLKGLVTNIKVPIRFEASLDDSKRSAQMREMLTQVAELSPLIEFAEVSNER
TPSFAIARVDSDVSVRIAGLPMGEEFSSFVLALVQVGGHPVREDEDLIEAIKGLTEPHEF
VTYMSLTCQNCPTVVQALNAMSVINPLIKHTAVEGGAFQDEVNERGIKAVPAVYMDGELF
GQGRMTLAEIVAKLDTNSGAKRAAKLNAVEPFDMLIVGGGPAGASAAVYAARKGLRVGVA
THNVGGQVLDTASIENLTVIDKIGGTELGSELNQSMTHYGVEVMSGLTATALHDKDAQAL
FAVDFDGDITLRAKSVVLATGARYRTTGVPGETEYRNNGVSFCPHCDGPLFKDKPVAVIG
GGNSAIEAAIDLAGICTHVTVVEMMPELKADEVLLEKLASLSNTTVVTSASLQSVEGNGT
DMTGLTYRDAAGDIHQVEANGMFVQIGLIPNAEWLEGTLELNRGAVVVDGKNATSMPGVF
AAGDITDIPYKQVLISLGAGANASLSAFDYLIRH
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgatgacaatacaatcactcagcttaagggcttagtaacaaacatcaaagtg
ccgattcgctttgaagcatcgcttgatgattcaaagcgttcggcgcagatgcgggaaatg
ctcactcaggtagctgaattatcgccgctgatcgaatttgccgaggtgagcaatgagcgc
actccatcgttcgctattgcccgggtggattcggatgtgtcagttcgtattgctggattg
ccaatgggggaggagttttctagcttcgtgcttgctcttgtccaagttggtggtcacccg
gttcgggaagacgaggatctgattgaggcgattaagggtctgaccgaaccacatgagttt
gttacatatatgtcgttaacgtgtcagaactgcccaacagtggttcaggctcttaatgcg
atgtctgtgattaacccattgattaagcacacagctgttgaaggcggtgcgttccaagat
gaggttaatgaacgtggcattaaagcagttcctgcggtttatatggatggtgaactcttt
ggccaaggtcgaatgactcttgctgaaattgttgccaagctagatacgaactcaggtgct
aagcgtgccgcgaagctcaatgcggttgagccgttcgatatgctgattgttggtggcggc
cctgccggtgcctcagcagctgtgtatgcggcccgcaagggattacgtgttggggtggct
acgcataatgtgggcggccaagtcctagatactgcatcaatcgagaacttaacagtgatc
gataaaattggcggtactgagttaggcagtgagcttaatcagtcgatgacgcactacggt
gtggaagtgatgtctggtttgacggctaccgcacttcatgacaaagacgctcaggcatta
tttgctgttgatttcgacggcgatatcaccttgcgtgcgaagtctgttgtgttagcaaca
ggtgctcgttaccggactactggtgttccaggagaaactgaataccgtaataatggtgtg
agcttctgtccgcattgtgacggcccgttgtttaaggacaagccagttgcagttatcggt
ggtggaaactcggctatcgaagcggcgatagatcttgctggtatctgtactcatgtcact
gttgttgagatgatgccggagctgaaagcagacgaagttctgcttgaaaagctagcgtca
ttgtctaatacaactgtggttacttctgctagcttacaaagcgttgaaggcaatggtacg
gatatgactgggctgacctatcgtgatgctgctggtgatattcaccaagttgaagctaac
gggatgttcgttcagatcggtttgatcccgaatgctgaatggctggaaggtactctagag
ctcaaccgaggtgcagttgttgttgatggcaagaatgccacctctatgcctggtgttttt
gcggccggtgatatcactgatattccatacaagcaggtacttatttcgcttggtgccgga
gctaatgcttcattgagcgcatttgattatctgattcgtcactga

DBGET integrated database retrieval system