KEGG   Actinomyces radicidentis: AXF14_00940Help
Entry
AXF14_00940       CDS       T04288                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ard  Actinomyces radicidentis
Pathway
ard00010  Glycolysis / Gluconeogenesis
ard00030  Pentose phosphate pathway
ard00051  Fructose and mannose metabolism
ard00052  Galactose metabolism
ard00680  Methane metabolism
ard01100  Metabolic pathways
ard01110  Biosynthesis of secondary metabolites
ard01120  Microbial metabolism in diverse environments
ard01130  Biosynthesis of antibiotics
ard01200  Carbon metabolism
ard01230  Biosynthesis of amino acids
ard03018  RNA degradation
Module
ard_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ard00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXF14_00940
   00030 Pentose phosphate pathway
    AXF14_00940
   00051 Fructose and mannose metabolism
    AXF14_00940
   00052 Galactose metabolism
    AXF14_00940
  09102 Energy metabolism
   00680 Methane metabolism
    AXF14_00940
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AXF14_00940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ard01009]
    AXF14_00940
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ard03019]
    AXF14_00940
Enzymes [BR:ard01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AXF14_00940
Protein phosphatases and associated proteins [BR:ard01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AXF14_00940
Messenger RNA biogenesis [BR:ard03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AXF14_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AMD88337
UniProt: A0A0X8JGR6
LinkDB All DBs
Position
214538..216856
Genome map
AA seq 772 aa AA seqDB search
MRIGILTSGGDAQGMNAAVRSVVRTALRMGAQPYAVMEGWSGAVKGGDGIRPLEWDSVGS
ILHKGGTIIGTARCAEFRERAGQLDAAASLLEHGIDRLVVIGGDGSLTGTNEFRKNWPGL
VAELAETGRITPQTAQAHPELMVTGLVGSIDNDLVGADMTIGTDSALHRILEAIDDISST
AASHQRTFVVEVMGRHCGYLALMAAVAGGCDYVLVPELPPAEGWEEDMCLKLRTGREAGR
RESMVIVAEGATDRAGNRITADDVSRIIHDRLGEDPRVTILGHVQRGGRPSAYDRWMSTL
LGCAAAREVVLARPEEEPVIIAERHNRIHRLPMMEHIGRTRAVARLVEDGDYEGAIEARG
ASFGQMLELFETMSTPPVLDPAAIGELHHRAESDDGAAPARSRRIAIVHAGGLAPGMNTA
ARAAVRLGLDHDFTMLGVNGGFPGLLDGDVRELSWDDVEGWVGDGGAELGTRREVPTVEQ
LYALGRSIESHDIDGLLVIGGFNAYLAANLLVRERDRYPAFNIPIVCVPASIDNNLPGSE
LSVGADTALNNAVASLDAIKQSGAASHRCFVAEVMGRRCGYLSLMSGLAAGAEKVYLHED
GITLSELAADSERMVDSFRAGRKLYLVVRNERASEGYTTDVLAKIFTEEGHGLYDVREAI
VGHVQQGGDPTPFDRIMATKLVSHALGLLSDQLDAGTYHSSYVGLVEGRITHHPLERMNE
ELDLVNRRPREQWWMGLRDAISLVSQEEGELAPEDLPAFGPSRAEAERAARA
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatcggcatcctcacctccggcggcgacgcccagggcatgaacgcggccgtgcga
tccgtcgtccgcacggcgctgcgcatgggcgcccagccctacgccgtcatggagggctgg
tccggggccgtcaagggcggcgacgggatccgcccgctcgagtgggactcggtcggctcc
atcctccacaagggcggcacgatcatcggaaccgcgcgctgcgccgagttccgcgagcgc
gccgggcagctcgacgccgccgccagcctcctcgagcacggcatcgaccgcctcgtcgtc
atcggcggggacggatcccttaccggcacgaacgagttccgcaagaactggcccgggctc
gtcgccgagctcgccgagaccgggcgcatcaccccccagaccgcgcaggcccaccccgag
ctcatggtgactggcctggtcggctccatcgacaacgacctcgtcggcgccgacatgacg
atcggcacggactccgcgctgcaccgcatcctcgaggccatcgacgacatctcctccacg
gcggcgagccaccagcgcaccttcgtcgtcgaggtcatgggccgccactgcggctacctc
gcgctcatggccgccgtcgccggcggctgcgactacgtcctcgtccccgaactcccgccc
gccgagggctgggaggaggacatgtgcctcaagctgcgcaccggccgcgaggcggggcgc
cgcgagtccatggtcatcgtcgcggagggcgccaccgaccgcgccggcaaccgcatcacg
gccgacgacgtcagccgcatcatccacgaccggctcggcgaggacccccgtgtcacgatc
ctcggccacgtccagcgaggcgggcgtcccagcgcctacgaccgctggatgtcgaccctc
ctgggctgcgccgccgcccgcgaggtcgtgctggcccgcccggaggaggagcccgtcatc
atcgccgagcgccacaaccgcatccaccgcctgccgatgatggagcacatcggccgcacg
cgcgccgtcgccaggctcgtcgaggacggcgactacgagggcgccatcgaggcccgcggc
gccagcttcgggcagatgctcgagctcttcgagaccatgtccactcccccggtgctcgac
ccggcggccatcggcgagctccaccaccgcgccgagtccgacgacggcgccgcgccggcg
cgctcgcgccgcatcgcgatcgtccacgccggcggcctcgcaccgggcatgaacacggcg
gcgcgcgcggcggtccggctcgggctggaccacgacttcaccatgctcggcgtcaacggc
ggcttcccggggctgctggacggcgacgtgcgggagctgtcctgggacgacgtcgagggc
tgggtcggcgacggcggtgccgagctcggcacgcgccgcgaggtgccgaccgtcgagcag
ctgtacgcgctgggccgctccatcgagtcccacgacatcgacggcctcctcgtcatcggc
ggcttcaacgcctacctcgcggcgaacctgctcgtgcgcgagcgggaccgctaccccgcc
ttcaacatcccgatcgtgtgcgtgccggcgtcgatcgacaacaacctgcccggctccgag
ttgagcgtcggggcggacacggccctcaacaacgccgtcgcctccctggacgccatcaag
cagtccggtgcggcgtcgcaccgctgcttcgtcgccgaggtcatgggccgcaggtgcggg
tacctgtccctcatgagcggcctcgcggccggcgcggagaaggtctacctccacgaggac
ggcatcaccctgtccgagctggcggccgactccgagcggatggtcgactccttccgggcc
ggccgcaagctctacctcgtcgtccgcaacgagcgggcgagcgagggctacacgacggac
gtcctcgccaagatcttcaccgaggaggggcacggcctctacgacgtgcgcgaggcgatc
gtcgggcacgtccagcagggcggcgaccccacccccttcgaccgcatcatggcgacgaag
ctcgtctcccacgcgctggggctcctctccgaccagctcgacgccgggacgtaccactcg
agctacgtcgggctcgtcgagggccgcatcacccaccaccccctggagcgaatgaacgag
gagctcgacctcgtcaaccgccgtccgcgcgagcagtggtggatggggctgcgcgacgcg
atctcgctcgtgagccaggaggagggcgagctggcgccggaggaccttccggccttcggc
ccgagccgcgccgaggcggagcgggccgcgcgcgcctga

DBGET integrated database retrieval system