KEGG   Actinomyces radicidentis: AXF14_02085Help
Entry
AXF14_02085       CDS       T04288                                 

Definition
(GenBank) hypothetical protein
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ard  Actinomyces radicidentis
Pathway
ard01100  Metabolic pathways
ard01120  Microbial metabolism in diverse environments
ard01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ard00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AXF14_02085
Enzymes [BR:ard01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AXF14_02085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: AMD86605
UniProt: A0A0X8JCY3
LinkDB All DBs
Position
492811..493668
Genome map
AA seq 285 aa AA seqDB search
MINFRDTLAKYKHLTLMGINNALSARLAEQAGFQALWSSSLEVSASHGVPDASFLGMNQF
VEAAHQAQTAVDIPILADCDSGYGDSMNVAYMVRSYEDAGITAVCMEDNLFPKVNSLLDQ
RRTILGADEFVQKIVAAKSAQREDSFFVMARTESFIAGESVDELLARAEAYREAGADALL
FHAKAPHTEKLREALTCWGRKLPVAVVPTAYPRYSAPHLQEAGADIVIFANQGMRAAVRA
MQDVFATLSKHGSLLDVEEQIAPVSDIFECQDLTEWRRLADGTPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgattaacttccgcgacacactagccaagtacaagcacctgaccctgatggggatcaat
aacgctctgagcgctcgccttgccgagcaagcgggcttccaggcactctggtcctccagc
ctggaggtctccgcctcccacggtgtgcccgacgcgagtttcctgggtatgaaccagttc
gtcgaagcagcacatcaggctcagaccgccgtcgacatcccgatactggccgattgtgac
tccggctatggcgactcgatgaacgtcgcttatatggtccgcagttatgaggatgccggc
atcaccgccgtctgtatggaggacaacctgttccccaaggtgaacagcctcctggaccag
cgccgcaccatcctgggtgccgacgagttcgtccagaagatcgtcgccgccaagtccgcc
cagcgcgaggactctttcttcgtgatggcacgcaccgagagctttatcgcgggcgagtct
gtcgatgaactattggcccgtgccgaggcctaccgtgaggcgggcgccgacgccctcctg
ttccacgccaaggccccccacaccgagaagctacgcgaggctctcacctgttggggccgc
aagctccctgtggcggtcgtgccaacggcctacccgcgctactcggctccccacctccag
gaggcaggcgctgacattgtcatcttcgccaaccagggcatgcgtgcggccgtccgcgcc
atgcaggacgtcttcgccactctctccaagcacggttcgctgctggacgtcgaggagcag
atcgcgccggtgagcgacatcttcgagtgccaggacctgactgagtggcgccgcttggcc
gacggaacccccgcatga

DBGET integrated database retrieval system