KEGG   Actinomyces radicidentis: AXF14_07375Help
Entry
AXF14_07375       CDS       T04288                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ard  Actinomyces radicidentis
Pathway
ard00473  D-Alanine metabolism
ard01100  Metabolic pathways
ard01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ard00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXF14_07375
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AXF14_07375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ard01011]
    AXF14_07375
Enzymes [BR:ard01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AXF14_07375
Peptidoglycan biosynthesis and degradation proteins [BR:ard01011]
 Precursor biosynthesis
  Racemase
   AXF14_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMD88494
UniProt: A0A0X8JGP5
LinkDB All DBs
Position
1737072..1738316
Genome map
AA seq 414 aa AA seqDB search
MDLDALARNARVLADVAGTPWLAVVKADAYGHGIEAVATTCLAAGATWLGTAQVAEALHL
RALLDARGTSRPEPGLDAVPTPDAPRLLAWLVPFLTPEQAAAPGSALRQALAAGIDLSAS
TPAQVEALAAAARAEGRPARVHLKADTGMSRAGAVAEDVPALAAAARRAEEEGFLDVVGL
WSHLSRADEPDSGSTEEHLARFRAAEASVRAAGLTPRVRHLAATGGLLWHPDARLDLVRA
GIGLYGLSPDPSVATSSELGLSPVMRLEAPLVQVKRIPAGQAVSYGGTWTAPTDRWLGLV
PLGYSDGLPRAAASAGPVSVGGLRTTVVGKVCMDQVVIDLGPAADTEGEPVPAPAAPGDV
AVLWGDPGAPGADPATPTADDWAAVCGTINYEIVTRLGARVPRVTAGDGLPASH
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atcgacctcgacgccctcgcccgcaacgcccgcgtcctcgccgacgtcgccggcaccccc
tggctcgccgtcgtcaaggccgacgcctacggccacggcatcgaggccgtcgccaccacc
tgcctcgccgccggcgccacctggctgggcaccgcccaggtcgccgaggccctccacctg
cgcgccctcctcgacgcccgcggcacctcccgccccgagcccggcctcgacgccgtgccc
acgcccgacgccccacgtctcctcgcctggctcgtccccttcctcacccccgagcaggcc
gccgcccccggctccgcgctccgccaggcgctcgccgcgggcatcgacctctccgcctcc
acccccgcccaggtcgaggccctcgccgccgccgcccgggcggagggccgccccgcccgc
gtccacctcaaggccgacaccggcatgtcccgcgccggcgccgtcgccgaggacgtgccg
gccctggccgccgccgcccgccgagccgaggaggagggcttcctcgacgtcgtcggactg
tggtcccacctctcgcgcgccgacgagcccgactccggctccaccgaggagcacctggcc
cgcttccgcgccgccgaggcgtccgtgcgcgccgccggcctcaccccgcgcgtccgccac
ctcgccgccacgggcggactcctgtggcaccccgacgcccgcctcgacctcgtccgcgcc
ggcatcggcctgtacggcctgtccccggacccgagcgtcgcgacctcgtccgagctcggc
ctcagccccgtcatgcgcctcgaggcgcccctcgtccaggtcaagcggatccccgccggg
caggccgtctcctacggcggcacctggaccgcgcccaccgaccgctggctcgggctcgtg
ccgctcggctactccgacggcctgccccgcgccgccgcctccgccggccccgtcagcgtc
ggcggcctgcgcaccaccgtcgtcggcaaggtctgcatggaccaggtcgtcatcgacctc
gggcccgccgccgacaccgagggagagcccgtgcccgccccggccgcccccggcgacgtc
gccgtcctgtggggcgacccgggcgctcccggcgccgaccccgccacacccaccgcggac
gactgggccgccgtctgcggcaccatcaactacgagatcgtcacccgtctcggtgcccgc
gtcccgcgcgtcaccgccggcgacgggctccccgcgagccactga

DBGET integrated database retrieval system