KEGG   Arthrobacter sp. ERGS1 01: AL755_02075Help
Entry
AL755_02075       CDS       T04085                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
are00620  Pyruvate metabolism
are00680  Methane metabolism
are01100  Metabolic pathways
are01120  Microbial metabolism in diverse environments
are01200  Carbon metabolism
Module
are_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:are00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL755_02075
  09102 Energy metabolism
   00680 Methane metabolism
    AL755_02075
Enzymes [BR:are01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL755_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALE04487
UniProt: A0A0M4M5C2
LinkDB All DBs
Position
unnamed2:445796..448615
Genome map
AA seq 939 aa AA seqDB search
MSSELHPDPQGTFADPAEDSDLRRDVRRVSTLLGESLVRQHGPDLLAMVEQVRLLTKESK
EAARGETGTGPWSANDVAEQVREVLSSLPLEQATDLVRAFAFYFHLANAAEQVHRVRSLR
SRPEQDGWLAKAVTEIAEKAGSEALQKVVNELDVRPIFTAHPTEASRRSVLDKIRKLSDI
LATPSDEGSTARSRQDRKLAEIIDQMWQTDELRKVRPTPMDEARNAIYYLNNILTDAMPE
VLTELTDLLAVHDVKLPADAAPLRFGSWIGGDRDGNPNVTSDVTREVLVLQNANAVKNSI
ALIDELLTVLSNSSSLYGADKELTDSIAVDLAKLPGIDPRVLELNAEEPYRLKLTCIKAK
LLNTRKRVGADGYHEPGRDYANTAELIADLELLETSLRNNSAALVADGALASVRRAIASF
GLHLATLDIREHADHHHDAVGQLIDRVGELGKPYADLERDERMRVLSAELASHRPLSGHP
IKLDGIADGTYDVFRVVRRALHTYGPDVVETYIISMTRGADDVLAPAVLAREAGLVQLTG
ENRYAKIGFAPLLETVDELRASAEIVDQLLSDPSYRELVRLRGNVQEIMLGYSDSNKESG
VMTSQWEIHKTQRKLRDVALKHGVNVRMFHGRGGSVGRGGGPTYDAIMAQPNGVLEGAIK
FTEQGEVISDKYSLPELARENLELSLAAVMQGSALHQAPRHSEDDLVRFGEVMETISDAA
FGTYRTLIDHDDLPAYFLASTPVEQLGSLNIGSRPSKRPDSGSGLGGLRAIPWVFGWTQS
RQIVPGWFGVGSGLKAAREAGRGEELKEMLANWHFFSSTISNVEMTLAKTDMDIAAHYVR
TLVPEPLQHLFAAIRAEYELTVAEVQNLTGEVELLDKQPLLKRSLNVRDQYLDPISYLQV
ELLRRVREADISQSEVDERLQRAMLITINGVAAGLRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagaactgcatccagacccccagggcaccttcgccgatcccgccgaggactcc
gatcttcgccgcgacgtgcgccgcgtcagcacgctgttgggtgaatccctggtccgccag
cacggcccggacctgctggccatggtggaacaggtgcgcctgctgaccaaggaatccaag
gaagcggcccgcggcgagaccggcaccggcccgtggagtgccaacgacgtcgccgaacag
gtccgcgaggtcctctcctccctgccgcttgagcaggccaccgatctggtccgtgccttc
gcgttctacttccacctggccaacgccgccgaacaggtgcaccgcgtccgtagcctgcgc
tcgcggcccgagcaggacggctggctggccaaggccgtcaccgaaatcgccgaaaaggcc
ggctccgaagccctgcaaaaggtcgtcaacgaactcgacgtgcgccccatcttcaccgcg
caccccaccgaggcctcgcgccgctccgtgctggacaagatccgcaagctttcggacatc
ctggccacgccatcggatgagggcagcaccgcccgcagccggcaggaccgcaagctggcc
gaaatcatcgaccagatgtggcagaccgacgagctgcgcaaggtccgtcccacgcccatg
gacgaggcccgcaacgccatctactacctgaacaacatcctcacggacgccatgcccgag
gtgctcaccgagctcaccgacctcctggccgtccacgacgtgaagctgccggcggatgcc
gcaccgctgcgcttcggctcctggatcggtggcgaccgcgacggcaacccgaacgtcacc
tccgacgtcacccgcgaggtgctggtgctgcaaaacgcgaacgccgtgaagaacagcatc
gcgctcatcgacgaactcctgacggtcctctccaactccagctccctctatggtgcggac
aaggaactgaccgactccatcgccgtcgacctggccaagctgcccggaatcgatccgcgc
gtgctggagctgaacgccgaggaaccgtaccggctgaagctgacctgcatcaaggcaaag
ctgctgaacacgcgcaagcgcgttggcgccgacggctaccacgagcccggccgcgactac
gccaacaccgccgagctcatcgccgacctggaactgctggaaacatcgctgcgcaacaac
tcggccgccctggtggccgacggcgccctggcctccgtgcgccgcgcgatcgcctccttc
ggcctgcacctggccaccctggacatccgcgagcacgccgaccaccaccacgacgccgtc
ggccagctcatcgaccgcgtcggtgagctcggcaagccctatgcggacctggagcgggac
gagcgcatgcgcgtgctcagcgccgaactggccagccaccgcccgctgtccggccacccg
atcaagctcgacggcatcgccgacggcacctacgacgtcttccgcgtggtgcgccgggcc
ctgcacacctacggccccgacgtcgtcgaaacctacatcatctcgatgacccgcggtgcc
gacgacgtcctggccccggccgtgctggcccgcgaggccgggttggtccagctcacgggc
gagaaccgctacgcaaagattggcttcgccccgctgctggaaaccgtggacgagctgcgc
gcctccgccgagatcgtggaccaactgctttccgacccgtcctaccgggaactggtgcgc
ctgcgcggcaacgtccaggaaatcatgctcggctactcggactccaacaaggaatccggc
gtcatgaccagccagtgggaaatccacaagacccagcgcaagctgcgcgacgtggcactc
aagcacggcgtgaacgtgcgcatgttccacggccgcggcggctccgtgggccgcggtggc
ggacccacctacgacgccatcatggcccagcccaacggcgtcctcgaaggtgccatcaag
ttcaccgaacagggcgaggtcatctccgacaagtactcgctgcccgagctggcgcgcgag
aacctggaactgtcactggccgccgtcatgcagggttcggccctgcatcaggcgccgcgc
cactccgaggacgacctggtccgcttcggtgaggtcatggagaccatctccgacgccgcc
tttggcacgtaccggacgctcatcgaccacgatgacctgcccgcctacttcctggcctcc
acccccgtggaacagctgggcagcctgaacatcggctcccgcccgtccaagcggcccgac
tccggctccggcctgggcggcctgcgcgccatcccgtgggtgtttggctggacccagtcg
cggcaaatcgtgcccggctggttcggcgtgggctcgggcctgaaggccgcccgcgaggcc
ggccgcggcgaggaactgaaggaaatgctggccaactggcacttcttctcctccaccatt
tccaacgtggaaatgacgctcgccaagactgacatggacatcgccgcccactacgtgcgc
accctggtgccggaaccgctccagcacctgttcgccgccatccgtgccgaatacgagctc
acggttgccgaagtgcagaacctgacgggcgaggtggagctgctggacaagcagccgctg
ctcaagcgctccctgaacgtccgcgaccagtacctggacccgatctcctaccttcaggtg
gaactgctgcgccgcgtccgcgaggccgacatctcccagagcgaagtggacgagcgcctg
caacgcgccatgctcatcacgatcaacggcgtggccgccggcctgcgcaacacggggtag

DBGET integrated database retrieval system