KEGG   Arthrobacter sp. ERGS1 01: AL755_14275Help
Entry
AL755_14275       CDS       T04085                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
are00250  Alanine, aspartate and glutamate metabolism
are00410  beta-Alanine metabolism
are00430  Taurine and hypotaurine metabolism
are00650  Butanoate metabolism
are01100  Metabolic pathways
are01110  Biosynthesis of secondary metabolites
are01120  Microbial metabolism in diverse environments
are02024  Quorum sensing
Module
are_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:are00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL755_14275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL755_14275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL755_14275
   00430 Taurine and hypotaurine metabolism
    AL755_14275
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL755_14275
Enzymes [BR:are01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AL755_14275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 RNA_replicase_B
Motif
Other DBs
NCBI-ProteinID: ALE07846
UniProt: A0A0M4LEM1
LinkDB All DBs
Position
complement(2288560..2289888)
Genome map
AA seq 442 aa AA seqDB search
MVDSAFDGGVGTIPKHRLPRGSQDADAAMRFIQDELMLDGNARQNLATFVTTWMEPQATT
LIRASLEKNIIDKDEYPQSAEIERRCVNILADLWNAPTPTGGADAVGCSTTGSSEAAMLA
GMALKWRWRARREAAGLDAGKPNLVMGANVQVCWEKFARYWDVEARLVPLDGATHLTAAQ
AAAACDENTIGVVAVLGSTFDGSYEPVAEIAAALDALQADTGLDVPVHVDAASGGFIAPF
LDRELKWDFRLDRVRSINASGHKYGLVYPGVGWVLWRSEADLPKDLIFSVDYLGGSMPTF
ALNFSRPAAQVIAQYYTLVRYGFEGFRSIQQHSRDIARTIADGVGRLGPFTLLSHGEELP
VLAFSLTKPDGYTVYDLSHELRSYGWIVPAYPMPEGMADVDVLRVVVRNGFTFDLAAMFL
ADLAKSVDRLSGAAQARVAFHH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
attgtggactccgcgtttgacggcggagtggggacgatccccaagcaccggctgccgcgg
ggaagccaggacgccgacgcggccatgaggttcatccaggatgagctcatgctcgacggg
aatgcgcggcagaaccttgccacctttgtcacgacctggatggagccgcaggcgacgacg
ctgatcagggcgtcgctggagaagaacatcatcgacaaggacgagtatccgcagtcggcc
gagattgaacggcgctgcgtgaatatcctggccgatctttggaatgcacccacccccacg
ggaggggcggacgccgtgggttgttccaccacgggctcctcggaggccgccatgctggcc
gggatggcgttgaagtggcgctggcgggcccggcgggaggctgccggcctggacgccggc
aagcccaatctggtgatgggcgccaacgtgcaggtgtgctgggagaagtttgcccgctac
tgggatgtcgaggccaggctggtgccgctcgacggtgccacgcacctgaccgccgcccag
gcggccgccgcctgcgatgaaaacaccattggcgtggtggccgtgctcggctccaccttc
gacggatcctacgagccggttgcggaaatcgccgcggcgttggatgccctgcaggcggac
accgggctggacgtgcccgtccacgttgatgcggcgtccgggggtttcattgccccgttc
cttgaccgggagctgaaatgggacttccgcctggaccgggtgaggtccatcaacgcctcc
ggccacaaatacggactggtctaccccggggtgggctgggtgctgtggcgcagcgaggcc
gatctgcccaaggacctgatcttcagcgtcgactacctgggcggctccatgcccaccttc
gcgctgaacttctcccgcccggccgcccaggtcatcgcccagtactacacgcttgtccgg
tatggctttgaagggttccggagcatccagcagcactcacgcgacattgcccgtaccatc
gccgacggcgtggggcggcttggcccgttcacgctcctcagccacggggaggagcttccg
gtgctggcgttcagcctgacgaagccggacggctacacggtctacgacctctcgcacgaa
ctgcgcagctacggctggatcgtgccggcctatccgatgcccgagggcatggccgacgtc
gacgtgctgcgggtggtggtgcgcaacggcttcaccttcgacctggccgccatgttcctg
gctgatcttgccaagtcggtggacaggctctccggtgccgcgcaggcacgcgtggcgttc
caccactag

DBGET integrated database retrieval system