KEGG   Arthrobacter sp. ERGS1 01: AL755_15065Help
Entry
AL755_15065       CDS       T04085                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
are00473  D-Alanine metabolism
are00550  Peptidoglycan biosynthesis
are01100  Metabolic pathways
are01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:are00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL755_15065
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL755_15065
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AL755_15065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:are01011]
    AL755_15065
Enzymes [BR:are01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AL755_15065
Peptidoglycan biosynthesis and degradation proteins [BR:are01011]
 Precursor biosynthesis
  Amino acid ligase
   AL755_15065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ALE06473
UniProt: A0A0M5KTY5
LinkDB All DBs
Position
complement(2465720..2466862)
Genome map
AA seq 380 aa AA seqDB search
MTTESTATPVPGRVRVAILFGGRSSEHAVSCVTAAGVLGAIDRTKYDVVPIGIAKNGQWV
LAGDELAGWSLTGESLPEVASGERTVSLAQLGADQQLVVSEPAKVPEQLGAVDVVFPLLH
GPWGEDGTIQGLLELSDTRYVGAGVLASAIGMDKHFMKVVFEAAGLTVGPYVAVTDREWT
VNPSAVRERVAALGFPVFVKPARAGSSMGISKVDSLDGLDAAIAEAREHDLKLVIEAGIV
GREIEIAVLEGRGSDAPRVSLPGEIAMVDGDHHAFYDFAAKYVQGDAVNLSCPADMPEAD
IARIQAQAAAAFDAVGAEGLSRVDFFYTADGELVINEINTMPGFTPSSMYPQMWAASGLS
YPELIDELLQLALNRKTGLR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgactactgaatccaccgccacccctgtgcccggacgcgtccgggtcgccatccttttt
ggcgggcgctccagcgagcacgccgtcagctgtgtcacggcggccggcgtgctgggtgcc
atcgaccggaccaagtacgacgtcgtccccatcggcatcgccaagaacggccagtgggtt
ttggccggggatgaactggcgggctggtcgctgaccggcgaatccctgcccgaggttgcc
tcgggcgagcggacggtttccctggcccagctgggcgcggaccagcaactggtggtgagc
gagccggccaaggtgcccgagcagctcggtgccgtggacgtggtgttcccgttgctgcac
ggcccgtggggtgaggacggcaccatccaggggctgctggagctctccgacacccgctac
gtgggcgccggcgtgctggcctcggccatcggcatggacaagcacttcatgaaggtggtc
ttcgaggccgccggactcaccgtgggcccgtacgtcgccgtcaccgaccgcgaatggacc
gtcaacccgtcggcggtgcgcgagcgcgtggccgccctgggcttccccgtgttcgtcaag
cccgcccgcgcaggttcctccatgggcatttccaaggtggactcccttgacggtttggat
gccgcgatcgccgaggcccgcgaacacgacctgaagctggtcatcgaggccggcatcgtg
ggcagggaaattgaaattgccgtgctggagggccgggggagcgacgccccgcgagtctcc
ctgccgggcgagatcgccatggtcgacggcgaccaccacgcgttctacgacttcgccgcc
aagtacgtccagggcgacgccgtgaacctcagctgcccggcggacatgccggaggccgac
atcgcccgcatccaggcgcaggccgccgcggccttcgacgccgtgggcgccgagggcctg
tcccgggtggacttcttctacacggccgacggcgaactggtcatcaacgagatcaacacg
atgcccgggttcacgccgagctccatgtacccgcaaatgtgggccgcctcggggctttcc
tacccggagctgattgacgaactcctgcagctggcgctgaaccggaagaccggcctgcgc
taa

DBGET integrated database retrieval system