KEGG   Arthrobacter sp. ERGS1 01: AL755_21420Help
Entry
AL755_21420       CDS       T04085                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
are00040  Pentose and glucuronate interconversions
are00051  Fructose and mannose metabolism
are01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:are00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AL755_21420
   00051 Fructose and mannose metabolism
    AL755_21420
Enzymes [BR:are01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AL755_21420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 3HCDH_N XdhC_C ApbA 2-Hacid_dh_C FAD_binding_3 Pyr_redox_2 adh_short
Motif
Other DBs
NCBI-ProteinID: ALE07443
UniProt: A0A0M4LR41
LinkDB All DBs
Position
3880103..3881134
Genome map
AA seq 343 aa AA seqDB search
MTNQIAGSLPESMTASVLVRRGELRTEQRPIPAPGPGEVLVRITSVGVCGSDTHYFTEGR
IGPYVVDSPLVLGHEPAGVVVALGDGVANRSVGQRVSLEPGIPDPLSPQTLAGCYNLDPG
VRFFATPPIDGVFSEYAVHPAAFCHPVPDSVSDDAAALLEPLSVALAARSAGQIRIGDAV
LVAGAGPIGLLIAKVAQLAGATVTLTDVRAERLEVAKKYGAAHTFTAGNQPPVEPAFDVF
IDATGAEAAILGGLARLAPRGRCVLVGMGADTIALPVPLLQGRELVITGTFRYANTWPTA
IALAASGSIDLDGLVTSTHGLSDVEAALTAGANPGALKAMVRP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaaccagattgcaggctccctgcccgaatccatgaccgcttccgtgctggtgcgc
cgcggcgagctgcgcacggaacagcggcccatcccggcgcccggccccggcgaggtgctg
gtgcgaatcacgtccgtgggcgtatgcggctccgacacccattacttcacggagggccgc
atcggcccgtacgtggtggactcccccctggtgttgggccacgagccggccggcgtcgtc
gttgccctgggcgacggcgttgccaaccgttccgtgggccagcgcgtctcgctggagccg
ggcatcccggatccgctctcgccccagaccttggcgggctgctacaaccttgatcccggg
gtgcggttcttcgccaccccgcccattgacggcgtgttttccgaatacgccgtgcacccg
gccgcgttctgccacccggttccggattcggtgtccgacgacgcagccgcgctgttggag
ccgctcagcgtggccctggccgcaaggtctgcaggccagatccggatcggcgacgccgtg
ctggtggccggcgcggggcccatcggcctgctcatcgccaaggtggcgcagctggccggc
gccaccgtgacactgacggatgtgcgggccgaacggctggaggtcgcaaagaagtacggc
gctgcgcatactttcacggcgggtaaccagccgcccgtggaaccggccttcgacgtgttc
attgacgccacgggcgccgaagccgccatcctgggcgggctggcacggctggccccgcgg
ggtcgctgcgtgttggtgggcatgggcgcggacacgatcgcgctgccggttccgctgctg
cagggacgcgaactcgtgatcaccggtacattccggtacgcgaatacctggcccaccgcc
attgcgctggccgcctcgggcagcatcgacctggacgggctcgtcacctcgacgcacggg
ctttccgacgtcgaggcggcactcacggcgggcgccaacccgggcgcactgaaggccatg
gtccgcccctag

DBGET integrated database retrieval system