KEGG   Anaerostipes rhamnosivorans: AR1Y2_0743Help
Entry
AR1Y2_0743        CDS       T05962                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00520  Amino sugar and nucleotide sugar metabolism
arf01100  Metabolic pathways
arf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AR1Y2_0743
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AR1Y2_0743
Enzymes [BR:arf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AR1Y2_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 UPF0160
Motif
Other DBs
NCBI-ProteinID: QCP34197
UniProt: A0A4P8ICE3
LinkDB All DBs
Position
774495..775694
Genome map
AA seq 399 aa AA seqDB search
MMRRRIICMMLALCLLLCGCNIDGKKDYTKTEDLDEATLQGMAKDITKDMSLKQKIGQLF
MVSVYSLDSSGSKSQTKVTTAMKKTMKKYPVGGILLFSKNVESEKQLKKLTQDLQNASHV
PLFIAADEEGGTVSRIASKLPDSVTQFPQAREIGETYTDQQIAKMGKEQSKQLKDLGVNM
NLAPVADVLSNEDNTEIGNRSFGSDAKEVASIVKTLVKSMQKQQISATLKHFPGSGDALG
DTHRGAVETKQTIQELRKKEFLPFESGMDADSDAVMVSHLILTNVTDEKEPCSLSERVIS
DILRDEMEYDGLILTDAMNMNSITDNYSSGEAAVKAVKAGVNIVVMPEDLGQAYKAVKSA
VKNGRIKESVVDKAVRRIIYTKLKRGVIPPDTKLLEDNQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaagacgtattatatgcatgatgctggccctctgtcttttattgtgcggctgc
aacattgacggaaaaaaggattatacaaaaacagaggatctggacgaagctactctgcag
ggaatggccaaggatatcacaaaggacatgtcgttaaagcaaaagatcggacagcttttt
atggtatccgtctattcattagacagttccgggagcaagtcacagactaaggttacaact
gcaatgaaaaagactatgaagaagtatcccgtgggaggcattcttttgttttctaagaat
gtggaatccgaaaagcagcttaagaaacttacgcaggatctccagaatgcttcccacgta
ccgctttttatagcggcagatgaggagggagggacggtatcaaggattgcttctaaactc
ccggattcagttacccagtttcctcaggccagggagatcggggagacctatacggaccag
cagatcgccaagatgggaaaggaacagagcaagcagctcaaagacctgggggtcaatatg
aatctggctccggtggcagatgttctgtccaatgaggacaatacggagattggaaaccgg
tcctttggttccgatgcgaaggaagtggcatccattgtaaagacactggtaaagagtatg
cagaagcagcagatctcagccacgctgaagcattttcccggaagtggtgacgctttgggg
gatacccaccgtggagcggtagagacaaagcagacgatccaggagttgaggaaaaaagag
tttcttccatttgaaagcggtatggacgcggactcggatgcggtcatggtgtctcacctg
attcttaccaatgtgacagatgaaaaggagccctgcagtttaagcgagagggttatctct
gacattttaagggatgagatggagtatgacggactgatcctcaccgacgccatgaatatg
aattctatcaccgacaactacagctccggggaagctgctgtgaaggcagtgaaagcagga
gtgaacatcgttgtcatgcctgaggatctgggacaggcatataaggcagtcaaaagcgcg
gtgaagaacggcagaatcaaggagtccgtagtggataaggccgtgagacggatcatttat
acgaagcttaagagaggtgtgatccccccggataccaagcttctagaggataatcaataa

DBGET integrated database retrieval system