KEGG   Anaerostipes rhamnosivorans: AR1Y2_1190Help
Entry
AR1Y2_1190        CDS       T05962                                 

Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YdjJ
Organism
arf  Anaerostipes rhamnosivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox ADH_zinc_N_2 NAD_binding_3 AlaDh_PNT_C Gp_dh_N TrkA_N Pyr_redox_2 ThiF Sacchrp_dh_NADP ADH_N_2 F420_oxidored 2-Hacid_dh_C 3HCDH_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: QCP34644
LinkDB All DBs
Position
1216982..1218037
Genome map
AA seq 351 aa AA seqDB search
MKNSEAILVTPKQFEILECPVPDPKEHEILMKVEYVGMCGSDIHGFEFGPFIPPKDPNQK
IGLGHEVAGEVVKVGAKVTDFKPGDKVLIEPGVPDDSCEYCRTGRYNICPDVDFMATQPN
YKGALCEYMTHPAEWTYHVPEGMSTMEAALVEPAAVGMHAAIMGEARLGKSIVILGAGTI
GLMVLQACLSLGATDITVVDVMDKRLEFAKELGAARTINGAKEDTVEVLRSKELFGDHGV
ELVFECAGSAFTANQAVQVVARGGKIMMVGTQSNPVPIDFLKINREVTIQTSFRYCNNFP
QTIEAIATGKFNVKDMVTHIYDYKDVQQAFTDAIDPEKKLDMIKGVVKVAE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcagaagcaattctggtgacaccaaaacaattcgaaattttagaatgcccg
gttccagatccgaaagaacatgaaattttaatgaaagtcgagtatgtgggaatgtgtgga
tctgatattcatggattcgaattcggaccgtttatccctccgaaagatccaaatcagaag
atcggtctcggacatgaagtggcaggagaggttgtaaaggttggagccaaggttacagat
ttcaaaccgggagataaggtattgatcgagccgggagtaccggatgattcctgtgaatac
tgccgtaccgggcgatataacatctgccctgatgtagattttatggcaacacagccaaat
tacaaaggcgctttatgtgaatatatgacgcatccggcagagtggacctatcatgttcca
gaaggaatgtctacgatggaagctgcattggtagagccggcagccgttggtatgcatgcg
gcaattatgggagaggcaagacttggaaagagcattgtcatcttaggagcgggaacgatc
ggactgatggtacttcaggcttgtttaagcttgggagcaaccgatattaccgtagttgat
gttatggataaacgacttgagtttgcaaaggaactgggagcagcgagaacaatcaacgga
gcgaaagaagataccgtagaagttctccgttccaaagagttattcggagatcacggcgta
gaacttgtatttgaatgtgcaggatcagcatttacggcaaatcaggcagttcaggttgtg
gcaagaggcggaaagattatgatggtcggaacccagtcgaatcctgttccgattgatttc
ttaaagatcaaccgtgaagttacgattcagacttccttccgttactgcaataacttccca
cagacaatcgaggcgattgcaacaggaaagttcaatgtcaaagacatggtaacacatatt
tatgattacaaagacgtacagcaggcatttacagacgccattgatccggaaaagaaactg
gacatgatcaaaggtgttgtaaaggtagcagagtaa

DBGET integrated database retrieval system