KEGG   Anaerostipes rhamnosivorans: AR1Y2_2538Help
Entry
AR1Y2_2538        CDS       T05962                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B - Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00970  Aminoacyl-tRNA biosynthesis
arf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AR1Y2_2538
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:arf03029]
    AR1Y2_2538
Enzymes [BR:arf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AR1Y2_2538
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AR1Y2_2538
Mitochondrial biogenesis [BR:arf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AR1Y2_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: QCP35992
UniProt: A0A4P8IDS5
LinkDB All DBs
Position
complement(2549980..2551419)
Genome map
AA seq 479 aa AA seqDB search
MSRQYETVIGLEVHVELATKTKIFCGCSTEFGGEPNTHTCPVCTGMPGSLPVLNKQVVEY
AMAVGLATNCKITQNCKFDRKNYFYPDNPQNYQISQLYLPICRDGHVEIETDGEKKSIGI
HEIHMEEDAGKLIHDEWEDCSLVDYNRSGVPLIEIVSEPDMRSADEVIAYLEKLRLIIQY
LGASDCKLQEGSMRADVNLSIREAGAKEFGTRTEMKNLNSFKAIRRAIEGETDRQIALLE
EGKEVTQETRRWDDAKEKSYPMRSKEDAQDYRYFPDPDLAPVVISDEWIQTIKDAQPELR
DEKRSRYKETYGLPDYDIDILTGSKHLADIFEVTIAEGAEAKEVSNWLMGETMRLVNDSE
MDLEDISFAPQHLADLIAMVKSNEINRKVAKEVFEKIFKEDVDPKSYVEENGLKSMNDEG
AIKGTIEQIVKENPKSVEDYKAGKKKAIGFLVGQTMRATQGKADPGIVNKILKEILDKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaatatgagactgtcatcggtctggaagtccatgtggaactggcgacgaaa
acaaagattttctgtggatgcagcacagaattcggcggggagcccaacacccatacctgt
ccggtatgcaccggaatgccaggttctctccctgtattaaacaaacaggtagtggaatac
gccatggctgtgggactggctaccaattgtaagatcactcagaactgcaagtttgaccgt
aaaaattatttttatccggataacccgcagaactaccagatctcccagttatatctgcca
atctgccgggacgggcacgtggaaattgagacagacggagaaaagaaatccattgggatt
catgagatccatatggaagaggatgcaggaaagctgatccacgatgaatgggaggactgt
tctttggttgattataaccgttccggcgtaccgctgatcgagatcgtctctgaaccggat
atgcgttctgccgacgaagttatcgcttatctggaaaaattgagactgatcattcagtat
ctcggagcctctgactgtaaacttcaggaaggttctatgagggctgacgtgaatctctcc
ataagagaagcgggagccaaagaattcggaaccaggacggagatgaaaaacctgaactct
tttaaagccataaggcgtgcaattgagggagagacagaccgtcagattgcccttttagag
gaaggaaaagaagtgacccaggagacaagacgttgggacgatgccaaagaaaaatcctac
ccgatgcgctccaaggaggacgcccaggattaccgttatttccctgaccctgacctggca
ccggttgtgatcagtgatgagtggatccagacaataaaagatgcgcagccggagctacgt
gatgaaaaacgcagccgctataaggaaacatacggcctgccggattatgatatcgacatt
ctcactggaagcaagcatttggcagatatttttgaggtaacgatcgcagaaggagccgag
gcaaaggaagtctccaactggctgatgggtgagacaatgcgcctggtcaatgattcagag
atggatctggaggacatttcttttgcaccgcaacatctggcagatctgatcgccatggtg
aagagtaatgagatcaacaggaaagtggcaaaagaagtctttgaaaaaatcttcaaagaa
gatgtggatccaaagtcctatgtagaggaaaacggactgaaatctatgaatgatgaagga
gccattaagggaaccattgaacagatcgtaaaggaaaatccgaaatctgtggaggattac
aaagcaggaaagaaaaaagccattggattcctcgtgggacagaccatgagagcaacccag
ggcaaggcagatccgggtatcgtcaataagatactgaaagagattctggataaactataa

DBGET integrated database retrieval system