KEGG   Archaeon GW2011_AR20: QT11_C0001G0509Help
Entry
QT11_C0001G0509   CDS       T03843                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
arg  Archaeon GW2011_AR20
Pathway
arg00440  Phosphonate and phosphinate metabolism
arg01100  Metabolic pathways
arg01120  Microbial metabolism in diverse environments
arg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arg00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    QT11_C0001G0509
Enzymes [BR:arg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     QT11_C0001G0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like PcrB ComA
Motif
Other DBs
NCBI-ProteinID: AJF62651
UniProt: A0A0B5HQB5
LinkDB All DBs
Position
complement(402286..403578)
Genome map
AA seq 430 aa AA seqDB search
MKRVYVGISADLLHHGHINVINEASKLGEVTIGLLTDKAIASYKRLPFLPYDQRKIIIAN
IKGVKDVIPQETLDYAENLRKIKPDYVVHGDDWQEGVQKKTREKVIEVLKEWGGQLVEVP
YTKNISSGQLNKALREIGYTPEIRMKNLRRLLNSKELVRILEAHNGLTGYIVENAKVEKN
GVIKEFDGIWISSLTDSLAKGKPDNEVIDFTSRLSTINNILESTTKPMVVDGDTGGNVEH
FASMVKTLERLGVSAVIIEDKTGLKRNSLLGTDVEQIQDTIENFSAKIKTGKKSQITNDF
MIIARIESLILKKGVWEALIRAKAYIEAGADAIMIHSKEKSFDEIKDFCKQYSKFENKVP
LVVVPSTYSHVTEKELIDNGINMVIYANHLIRAAYPAMKKTAESILLNERAYEIEDSLTS
INDIINLIPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtctatgttggtataagtgcagatttattgcatcatggtcatattaacgta
atcaatgaagcaagtaaattaggagaagttactataggcttgttgacagataaagctata
gctagttataaaagactgccttttttaccttatgatcaaagaaaaattatcatcgcgaat
ataaaaggcgttaaagatgttattccacaagaaacattagattatgctgaaaatttaaga
aaaattaaaccagattatgttgttcatggtgatgactggcaagagggggtgcagaaaaag
actagagaaaaggtaattgaagttctaaaagaatggggtggccagttagtagaggtgcct
tataccaaaaatatctcttcaggtcagctaaataaagctttacgcgaaataggatatacc
cccgagataagaatgaaaaatttaagaagacttttaaattcaaaagaattagtaaggatt
cttgaggcgcataacggtcttacaggttatattgttgaaaatgctaaagttgaaaaaaat
ggcgtgattaaagaatttgatggaatctggataagcagcttaaccgattcattggcaaaa
ggcaagccagataacgaggttatagattttacttctagattatctacaataaacaacatc
ttagaatcaacaacaaaacccatggttgttgatggagatactggtggaaatgtagagcat
tttgcttcaatggttaagactttagaaagattgggagtttctgctgttatcatagaagat
aaaactggattaaagagaaattctctgcttggaacagatgttgagcagatacaggataca
atagaaaatttttctgccaagattaaaacaggaaaaaagagccagataacaaatgatttt
atgataatagcaagaatagaaagtctaattttgaaaaaaggggtgtgggaagctctcatt
agagcaaaggcatatatcgaagctggtgctgacgctataatgattcatagtaaagaaaaa
agctttgatgaaataaaagatttctgcaaacaatactctaaatttgaaaataaagttcca
ttggttgttgttccgtcaacatattctcatgtaacagaaaaagagcttatagataatgga
attaatatggtaatttatgctaatcatttaataagggctgcttatcctgcaatgaaaaaa
acagcggaatcaatacttttgaatgagagagcctatgaaattgaagattctttaaccagc
ataaacgacataataaatttaattccaaaataa

DBGET integrated database retrieval system