KEGG   Arthrobacter sp. Hiyo8: AHiyo8_00650Help
Entry
AHiyo8_00650      CDS       T04181                                 

Definition
(GenBank) probable DNA ligase
Organism
arh  Arthrobacter sp. Hiyo8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: BAS11762
UniProt: A0A0K2RAW6
LinkDB All DBs
Position
44328..45098
Genome map
AA seq 256 aa AA seqDB search
MLDGEAVIWSGGRLDFEALQRRLVASKAGLAGMVRELPASYVAFDLLAVAGHDIREVVWS
RRRELLEELARTWVPPLNLSPTTTDRELAEEWFRNLPSTGVEGLMIKGSEQAFEASRIWL
KVKRRNNLDVVVAAVTGSIGRPSTVVVGLPMYGRLRIVGRSSVLSAAMSRNLGRYLRRPV
GNHPWPEEIPATWLDRFSKDREPVRLTLVEPIVVEVSADVAWSDRAFRHSVRVLRARPDL
DPADVTIPEKLEPPLP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgatggtgaggcggtcatctggtccgggggccggctggatttcgaggcgctgcag
cgccgcctagttgcctccaaggcaggcctcgccgggatggtgcgggagctacctgcttcg
tatgtggccttcgatctccttgctgtggccggccatgacatcagggaagttgtatggtcc
cgtcgtcgggagcttctggaagaactcgcgcgcacgtgggttccgccgctgaacctctcc
ccgaccacaacagacagggagctcgcggaggagtggtttcggaacctgccctcaacaggg
gtagaaggcctgatgatcaagggctcggagcaagcttttgaggcgtcccggatctggttg
aaggttaagcgacgcaataacctggatgtggtggttgccgcggtgacaggatccattggc
cgtccttcaaccgtggtggtggggctgccgatgtacgggcggttgcggatagtgggccgt
tcctctgttctgagtgctgcaatgtccaggaacctcggcaggtatctgcgccggcctgtg
gggaatcacccctggcccgaagagatcccggcgacatggttggaccggttcagcaaggac
agggagccggtccggctgaccttggtggagccgattgttgttgaggtctcggcggacgtg
gcctggtcagacagggccttccgccattctgtgcgcgtgctgcgggcgcgcccggatctg
gaccccgccgatgtcaccattcctgagaaactggagcctccattgccctag

DBGET integrated database retrieval system