KEGG   Arthrobacter sp. Hiyo8: AHiyo8_18940Help
Entry
AHiyo8_18940      CDS       T04181                                 

Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00020  Citrate cycle (TCA cycle)
arh00480  Glutathione metabolism
arh01100  Metabolic pathways
arh01110  Biosynthesis of secondary metabolites
arh01120  Microbial metabolism in diverse environments
arh01130  Biosynthesis of antibiotics
arh01200  Carbon metabolism
arh01210  2-Oxocarboxylic acid metabolism
arh01230  Biosynthesis of amino acids
Module
arh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
arh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHiyo8_18940
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AHiyo8_18940
Enzymes [BR:arh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AHiyo8_18940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: BAS13591
UniProt: A0A0K2RFH9
LinkDB All DBs
Position
complement(1329408..1331735)
Genome map
AA seq 775 aa AA seqDB search
MTLHSALEAVPVRANPAPSGKLEMLKSADFQGDAPPMAKIIYTHTDEAPMLATYSFLPIV
EAFASTAGVEVETRDISLAGRIIAVFGDYLTEEQRISDALAELGELAKKPEANIIKLPNI
SASVPQLKAAIAELQGQGYALPDYPDNPSSDEETDIRSRYDKIKGSAVNPVLREGNSDRR
APLSVKNYARQNPHSMGAWSADSKTNVAHMTENDFRSNEKSVVIPADDTIKIQIVREDGT
VKVLKPAFPVLAGEVVDGTVLRAAALDEFLAAQVVRAKEEGVLFSAHLKATMMKISDPII
FGHVVKAYFSELFDTYGKQIAAAGLSANNGLASILNGLDELPEDVREGIKAAIKKGLEDG
PALAMVDSDKGITNLHVPSDIIVDASMPAMIRSSGHMWGPDGKEADTLAVIPDSCYADVY
QVVIDDCRAHGAFDPTTMGTVPNVGLMAQAAEEYGSHNKTFEVEYAGTMQVVDSSGTVLI
EHQVSPGDIWRACQTKDVPIRDWVKLAVTRARASKMPAVFWLDETRAHDAQLIAKVKEYL
KDHDTEGLQIEIMSPEKATAFTLERIRKGEDTISVTGNVLRDYLTDLFPILELGTSAKML
SVVPLINGGGLFETGAGGSAPKHVQQLLQENHLRWDSLGEFLALAVSFEHLATTTGNARA
QVLADTLDRATGTFLLDNKSPKRRVGELDNRGSHYYLAKYWAQELAQQSDDTELAAAFSA
VAEALTANEDTIIAEMLGVQGSPADIGGYYRPDAAKAEAVMRPSAKLNEVVATLN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgcacagcgcgcttgaggccgtcccggtacgcgccaatccggccccctcaggt
aagttagagatgttgaaatctgcagactttcagggagatgccccgccaatggcaaagatt
atctatacccacactgacgaagcgccgatgctggcgacgtactcgttcctgccgattgtg
gaagctttcgcctcaacggccggcgtggaggtcgagacccgcgacatttcgctggccggc
cgaatcatcgccgtcttcggtgactacctgactgaagagcagcggatcagtgacgcactg
gctgaactgggcgaactggcaaagaagcccgaggcgaacatcatcaagcttcccaacatc
agcgcgtccgtccctcagctgaaggcagccattgccgaactgcagggtcagggctacgcg
cttccggactacccggacaacccctcctccgacgaagagacggacatccgctcgcgttac
gacaagatcaagggctcggccgtgaacccggtcctgcgtgaaggcaactcggaccgccgc
gcgcccctgtcggtgaagaactacgcccgccagaatccgcactccatgggtgcctggagc
gccgactccaagaccaacgttgcgcacatgacggagaacgacttccgctccaacgagaag
tccgtggtcatcccggccgacgacaccatcaagatccagatcgtccgcgaagacggcacc
gtcaaggtcctcaagccggccttccccgtcctcgccggtgaagtagtggacggcaccgtg
ctgcgcgccgctgccctggacgagttcctggctgcccaggtggtccgcgccaaggaagaa
ggcgtgctgttctcggcacacctgaaggccaccatgatgaagatctccgatccgatcatc
ttcggccacgttgtcaaggcgtatttctctgagcttttcgacacctacggcaagcagatc
gctgctgccggcctgagcgccaacaacggcctcgcctccatcctgaacggcctcgatgaa
ctcccggaagacgtccgcgaaggcatcaaggcggccatcaagaagggcctggaagacgga
ccggcgctggccatggtcgattcggacaagggcatcaccaacctccacgttcccagtgac
atcattgttgacgcttcgatgccggcgatgatccgcagctccggccacatgtggggaccg
gacggcaaggaagccgacactctcgcggtcatcccggacagctgctatgcagatgtctac
caggtggtcatcgatgactgccgtgcccacggcgccttcgatcccaccaccatgggtacg
gttccgaacgtcggcctgatggcacaagcggctgaggaatacggcagccacaacaagacc
ttcgaggttgagtacgccggaaccatgcaggttgtggattcttccggaaccgtgttgatc
gaacaccaggtctccccgggcgacatctggcgcgcctgccagaccaaggacgtgccgatc
cgcgactgggtcaagctggccgtcacccgtgcccgcgcctccaagatgccggctgtcttc
tggctcgacgaaacccgcgcccacgacgcccagctgatcgccaaggtcaaggaatacctg
aaggaccacgacaccgagggcctgcagatcgagatcatgtccccggagaaggccaccgcg
ttcacgctggagcggatccgcaagggcgaagacaccatctcggtgaccggcaacgtgttg
cgtgactacctcaccgacctgttcccgatcctcgagcttggcaccagcgccaagatgctc
tccgtggtcccgctgatcaacggcggcggccttttcgagaccggtgccggcggctcggct
ccgaagcacgtccagcagctcctgcaggaaaaccacctgcgctgggacagcctgggcgaa
ttccttgccctggccgtcagtttcgagcacctcgccaccaccaccggcaacgcccgggca
caggtcctcgcggacacgctcgaccgcgccaccggcacgttcctgctcgacaacaagtcc
ccgaagcgcagggtgggcgaactcgacaaccgaggcagccactactacctcgcgaagtac
tgggcacaggaactggcccagcagagcgacgatacggagctcgccgccgcgttctccgcc
gtcgccgaggccctgacggccaacgaggacaccatcattgccgagatgctcggagtccag
ggttcgcctgccgacatcggcggctactaccgccccgacgccgccaaggcggaggccgtg
atgcgaccttcagcaaagctcaacgaggttgtcgccaccctgaactag

DBGET integrated database retrieval system