KEGG   Arthrobacter sp. Hiyo8: AHiyo8_48260Help
Entry
AHiyo8_48260      CDS       T04181                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00010  Glycolysis / Gluconeogenesis
arh00071  Fatty acid degradation
arh00350  Tyrosine metabolism
arh00625  Chloroalkane and chloroalkene degradation
arh00626  Naphthalene degradation
arh01100  Metabolic pathways
arh01110  Biosynthesis of secondary metabolites
arh01120  Microbial metabolism in diverse environments
arh01130  Biosynthesis of antibiotics
arh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHiyo8_48260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AHiyo8_48260
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AHiyo8_48260
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AHiyo8_48260
   00626 Naphthalene degradation
    AHiyo8_48260
Enzymes [BR:arh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AHiyo8_48260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAS16523
UniProt: A0A0K2RNW0
LinkDB All DBs
Position
3464220..3465242
Genome map
AA seq 340 aa AA seqDB search
MTTTMQAAVVTEFGQDLQIQSLPLPAPGRGEALVKVITSGVCHTDLHAAEGDWPVKPSPP
FVPGHEGVGEVVALGEGVTDLAVGDLVGNAWLWSACGDCQFCRTGWETLCEAQKNAGYSV
DGSFGEYMLVDSRFAARIPAGSDPVEVAPVLCAGVTVYKGLKMTEAKPGQWVTISGIGGL
GHIAVQYAVAMGLRVAAVDIADDKLALARKHGAELTVNALHEDPAEVIQRETGGCHGVLV
TAVHPSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEAL
DFYAQGKIHPTVSTRELSEVNAVFDEMKHAKIDGRVVLRF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacaatgcaagcagccgtagtaacagaattcggacaagaccttcagatccag
tcacttccccttcccgcgcccggtcgaggagaagcgctggtcaaggtcatcaccagcggc
gtgtgccacaccgacctgcatgccgccgagggggactggccagtcaagccttcaccgccg
ttcgtgcccggccacgaaggcgtgggtgaagtggttgccctcggcgagggcgtcaccgac
cttgccgtcggggacctggtgggcaacgcctggctatggtccgcctgtggcgattgccag
ttctgccggaccggttgggagacgctgtgcgaagcccagaagaacgccggctatagcgtg
gacggttccttcggtgagtacatgctggtggacagccggttcgctgcgaggatcccggca
ggttcggaccccgtagaggtcgccccggtgctgtgcgccggagtcacggtctacaaggga
ttgaagatgaccgaggccaagccgggccaatgggtcactatttccggcatcggcggccta
ggacacatcgcagtccagtacgccgtggccatgggcctgcgggttgccgctgtggacatc
gccgacgacaagctcgccctcgccaggaaacacggcgccgagctcacggtcaacgcgctg
cacgaagatccggcggaagtcattcaacgggaaaccggaggctgccacggcgtcttggtc
acggcggtgcacccctcggcgttcgggcaggcgatcggcatggcccgccgtggcgggacc
atcgtcttcaacggactcccgccgggagacttccccgcgccgatcttcgagatcgtgctc
aagggcctgaccgtccgtggttcgatcgtgggaacacgccaggacctggaggaagccctg
gacttttacgcgcagggcaagatccacccgaccgtgtccacgcgggagctctccgaggtg
aacgcggtctttgacgaaatgaagcatgccaagatcgacggccgcgtggtgctgaggttc
taa

DBGET integrated database retrieval system