KEGG   Arthrobacter sp. Hiyo8: AHiyo8_52820Help
Entry
AHiyo8_52820      CDS       T04181                                 

Definition
(GenBank) probable aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00220  Arginine biosynthesis
arh00250  Alanine, aspartate and glutamate metabolism
arh00290  Valine, leucine and isoleucine biosynthesis
arh01100  Metabolic pathways
arh01110  Biosynthesis of secondary metabolites
arh01130  Biosynthesis of antibiotics
arh01210  2-Oxocarboxylic acid metabolism
arh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHiyo8_52820
   00290 Valine, leucine and isoleucine biosynthesis
    AHiyo8_52820
   00220 Arginine biosynthesis
    AHiyo8_52820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arh01007]
    AHiyo8_52820
Enzymes [BR:arh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AHiyo8_52820
    2.6.1.66  valine---pyruvate transaminase
     AHiyo8_52820
Amino acid related enzymes [BR:arh01007]
 Aminotransferase (transaminase)
  Class I
   AHiyo8_52820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP ComA
Motif
Other DBs
NCBI-ProteinID: BAS16979
UniProt: A0A0K2RQ77
LinkDB All DBs
Position
3777874..3779094
Genome map
AA seq 406 aa AA seqDB search
MAEFKQSTKLHNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLEVGD
EILIPTPDYPLWTASVALAGGRPVHYLCDEESGWQPDLEDMESKITPQTKGIVVINPNNP
TGAVYPEETLKKIVALAEKHGLVVFADEIYEKILYEDAVHVNLAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGINLLANMRLCANVPAQHAIQTALGGHQSINDL
ILPGGRLLEQRNKAYDLLNAIPGVSTQQARGALYLFPKLDPEVYHIRDDEKFVLDLLKEQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAIGRMADFLGRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaagcagtccaccaagcttcataatgtcctttacgacatccgtggaccg
attcttcaggccgcccagcagatggaggcagagggtcaccgcatcctcaaactgaatatc
ggaaacccggcaccgttcggatttgaagcgccggacgcgatcttggtggacatgatccgc
cacctgccgcatgcccagggatacagcgattcgcgcggaattttctcggcccgtaccgcc
gtctcgcagtactaccagacccgcggcatccaaaacatccacgttgacgacatctacctt
ggcaacggcgtcagcgagctcatcaccatgtccctcatggccttgctggaggtgggggat
gagatcctcattcccactcccgactacccgctctggaccgcctcggtggcacttgccggc
ggccgtccggtccactatctgtgcgacgaggaatcgggctggcagccggacctcgaggac
atggaatcgaagatcacgcctcaaaccaagggcatcgtggtcatcaaccccaacaacccc
acgggtgccgtgtacccggaggaaaccctcaagaagatcgtggccctcgctgaaaagcat
ggactcgttgtgttcgccgacgagatctacgagaagatcctctacgaagacgctgtccac
gtgaatcttgccggactcaccggcgacgatgtcctctgcctgacgttcagcggattgtcc
aaggcctaccgggtatgtggctaccgcgccggctggatggcgatctccggccccaagaaa
gacgccgcagactacctcgagggcatcaacctgctggccaacatgcgcctttgcgccaac
gtgccggcccagcatgccatccagaccgccctcggtggccaccaaagcatcaacgatctc
atcttgcccggcggcaggctcctcgaacagcggaacaaggcctacgatctgctcaacgcc
atccccggtgtcagcacacaacaggccaggggtgccctctatctgttcccgaagttggac
cccgaggtctatcacatccgcgacgacgagaaattcgtcctcgacctgctcaaggaacaa
aaaatcctcgtctcacacggacgcgccttcaactgggtgcggcctgaccacttccgcatg
gtgaccttgccgaacgtcaaggatattgaagaagcgattggacgcatggcggacttcctc
gggcggtaccaaggcaactag

DBGET integrated database retrieval system