KEGG   Arthrobacter sp. Hiyo8: AHiyo8_pI68050Help
Entry
AHiyo8_pI68050    CDS       T04181                                 

Definition
(GenBank) uncharacterized aminotransferase BpOF4_10225
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00250  Alanine, aspartate and glutamate metabolism
arh00410  beta-Alanine metabolism
arh00640  Propanoate metabolism
arh00650  Butanoate metabolism
arh01100  Metabolic pathways
arh01120  Microbial metabolism in diverse environments
Module
arh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AHiyo8_pI68050
   00650 Butanoate metabolism
    AHiyo8_pI68050
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHiyo8_pI68050
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHiyo8_pI68050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arh01007]
    AHiyo8_pI68050
Enzymes [BR:arh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AHiyo8_pI68050
Amino acid related enzymes [BR:arh01007]
 Aminotransferase (transaminase)
  Class III
   AHiyo8_pI68050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAS18501
UniProt: A0A0K2RUI5
LinkDB All DBs
Position
pHiyo8-1:complement(162882..164162)
Genome map
AA seq 426 aa AA seqDB search
MTSLSPVLKQATPVVVDHALGSWIFGTDGEQYLDFTTGIGVTSTGHCHPKVVAAAREQVG
KIIHAQYTTVMHKPLLELTEKLGEVLPAGLDSVFYANSGSEAVEAAIRLARMATGRPNIV
VFQGGFHGRTVAAASLTTAGTKFSAGFAPLMAGVHMSVFPHMYRYGMDEASVVAFALREL
DYLFKTRTAPEDTAAFLIEPALGDGGYIPTPPAFMDGLRERANRHGIQLIFDEVQAGVGR
TGKFWATSTPRRPQISSSPPRRRLRLPISAIAASTETMSKAWPGSQGGTYGGNAVSAAAG
VATLEVIEEEGLVENARVRGNQMLAGLKEIRARFPAIGNVRGIGLMAGIEFTAPDGTADA
ATATAVQQATVEQRLLTLTCGPEGNVVRLIPALIVTEAEIATGLERFEAAVAAVLGAPVA
PAGAGS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgacttctctgagccccgtcctgaagcaggcgacgcccgtggtcgtagaccatgctctc
ggcagctggatcttcggcaccgacggcgagcagtacctggacttcactaccggcatcgga
gtgaccagcacgggccactgccaccccaaggtcgtcgcggctgcccgcgaacaggtcggc
aagatcatccacgcccaatacacgacggtgatgcacaagcccttgcttgagctgaccgag
aagctaggagaagtcctcccggccgggctcgattcggtgttctacgcgaactccggctcc
gaggcggtcgaggccgcgatccggctggctcggatggcgacgggacgtcccaacattgtg
gtgttccaaggcgggttccacggccgcaccgtggccgctgcctcgctcacgacggccggg
acgaagttctccgcgggcttcgcaccgctcatggcgggcgtgcacatgtccgtcttcccg
cacatgtaccgctacggcatggacgaggcgagcgttgtggccttcgcgctcagggagctc
gactacctcttcaagacccgcaccgctcccgaggacacggccgcgtttctcatcgaaccg
gcgctgggcgacggcggctacatccccacccctccagccttcatggacggcctgcgcgag
cgggccaaccgccatgggatccagctcatcttcgacgaggtccaggcaggcgtcgggcgc
acgggcaagttctgggccaccagcactcccaggcgaccccagatatcatcgtcaccgcca
aggcgtcgcctccggcttcccatctcggcgatcgccgcctccaccgagaccatgtccaag
gcctggcccggctcccaaggcggaacctacggcggcaacgctgtctctgcagcagcgggc
gtggcgaccctcgaggtgatcgaggaggaggggctcgtcgagaatgcccgcgtccgcgga
aaccagatgctggccgggctcaaggagatccgggctcgcttccccgcgatcggtaacgtt
cgaggcatcggcctcatggccggcatcgagttcaccgcaccggacggcacggccgacgct
gccaccgccacggccgtgcagcaggcaaccgtcgagcagcgactcctgaccctcacatgt
gggccggagggcaatgtcgtccggctcatcccggccctcatcgtgaccgaggcagagatc
gccactggactcgaaagattcgaagcggccgtcgccgcagtcctcggcgcgccggtagca
ccggcaggagccggttcctga

DBGET integrated database retrieval system