KEGG   Arthrobacter sp. IHBB 11108: UM93_10005Help
Entry
UM93_10005        CDS       T03775                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ari  Arthrobacter sp. IHBB 11108
Pathway
ari00010  Glycolysis / Gluconeogenesis
ari00030  Pentose phosphate pathway
ari00051  Fructose and mannose metabolism
ari00052  Galactose metabolism
ari00680  Methane metabolism
ari01100  Metabolic pathways
ari01110  Biosynthesis of secondary metabolites
ari01120  Microbial metabolism in diverse environments
ari01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ari00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM93_10005
   00030 Pentose phosphate pathway
    UM93_10005
   00051 Fructose and mannose metabolism
    UM93_10005
   00052 Galactose metabolism
    UM93_10005
  09102 Energy metabolism
   00680 Methane metabolism
    UM93_10005
Enzymes [BR:ari01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UM93_10005
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     UM93_10005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AJT41765
UniProt: A0A0D4C034
LinkDB All DBs
Position
2140425..2141447
Genome map
AA seq 340 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIKIHGQEFVGFRDGWRGVVEGDIMDLPRQSVRGI
SKQGGTILGTSRTNPFDGGGPEVIKAHMDRLGIEAIIAIGGEGTLAAAKRLTDVGLKIVG
VPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHAG
MASGAHAILIPEQKVSIEQIAEWVLDAHERGRAPLVVVAEGFVPEHLESPHSERGLDTFG
RPRLGGIGDQLSSQLEERTGIETRATILGHIQRGGVPTAYDRVLATRLGMAAIDSVVDGH
WGTMVALSGTNIVHVPFEAALGNLKTVPQSRYDEASILFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggtatcctgaccagcggcggcgactgccccggacttaacgctgtgattcgc
ggcgcggtgctgaaaggcatcaaaattcacggtcaggagttcgtcggtttccgtgacggc
tggcgtggcgtagtcgagggcgacatcatggatctaccgcggcagagcgtgcgaggcatc
tccaaacagggtggcaccattttgggtacttcccggactaatcctttcgacggcggtggc
cccgaagtcatcaaagcccatatggatcgactgggcattgaggcgattattgccattggc
ggcgaagggaccctggccgccgctaaacggttgaccgacgttgggctcaagattgtcggc
gtgcctaagacggtcgataacgacctcgacgccaccgactacacctttggcttcgacacc
gccgtgcaaattgctaccgaagccatcgaccggctccgtaccaccggcgaatcccatcac
cgctgcatgatcgccgaagtgatgggtcggcacgttggctggattgcgctacacgccgga
atggcctcgggagcgcacgccatcctaatcccggaacagaaagtcagcatcgagcagatc
gctgaatgggtactggacgcccatgaacgtggtcgcgcgccgctggtggtggtagccgag
gggttcgttcccgagcacctggaatctccgcactcagagcgcggtttagataccttcggt
cggccgcggctcggcggcatcggcgatcagctctccagccagctggaggaacgcaccggc
attgaaacccgggcgaccattttggggcatatccagcgcggcggggtgccgaccgcgtat
gaccgggtgttggcgacgcggctggggatggcggccattgattcggtggttgacggtcat
tggggcaccatggtcgcgctctccggcacaaatattgtgcacgtaccttttgaagcggcc
ttgggaaatctcaaaaccgtgccgcagagccgatacgatgaagcctcgatcctctttggc
tag

DBGET integrated database retrieval system