KEGG   Psychromicrobium lacuslunae: UM93_10825Help
Entry
UM93_10825        CDS       T03775                                 

Definition
(GenBank) transporter
Organism
ari  Psychromicrobium lacuslunae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like UNC-93 MFS_3 Bac_export_2
Motif
Other DBs
NCBI-ProteinID: AJT41885
UniProt: A0A0D4C0D9
LinkDB All DBs
Position
complement(2302388..2303578)
Genome map
AA seq 396 aa AA seqDB search
MSHDGAEFSFKKIAIPAFGPSILFGVGEGAILPVIALSARDLGASVAVAALVVTLIGVGS
LISNIPASIVTDRYGERWSIVGAAVLSMLAMLLCVFAPNLWVYGLGVLLIGAASAVFNLA
RQKYLTEAVPLKYRARALSTLGGVMRIGIFIGPFIGALAINFFHLAGAYWVGVVAVIIAG
LIALSMPDLVHTAAGDGALASPTLRSTLLDHRKVFLSIGIGVLLVGAVRASRQAVLPLWA
EGLGLDPSTTSLIYGLSGAIDMLVFYPAGKLMDRRGRAWVAVPSMVLMGISLLLMPLTSG
AFGLLLVALLIGFGNGIGSGVVMTLGADYSPARGRAQFLGIWRFLADLGAFSGPALLSGI
TAILSLSVGIAATGLIGLGAAAVLWYWIPRTPKISA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcatgacggtgccgaattcagtttcaagaagattgctatccccgctttcggaccc
tcaatcctcttcggcgtcggtgaaggcgcaatcttgccggtgattgcactcagcgcccgc
gacctcggggcaagcgtggccgtcgcggccctggtggtaacgctgatcggtgtcggttcc
ctgattagcaatatcccggcctccatcgtgaccgaccgatacggggagcgatggtccatc
gtgggggctgccgtgctgagcatgctggccatgttgctctgcgtattcgcgccaaacctc
tgggtttacggtctgggagtgctgttgatcggcgccgcctcggcggtatttaacctggct
cggcagaagtatctgaccgaggctgtgccgctcaaatatcgcgcgagagcactctcaacg
ctcggtggagtgatgcggattgggatctttattggtccgttcattggcgcgctggcgatc
aatttcttccacctggctggggcttactgggtcggcgtggtggcggtcatcatcgcgggt
ctgatcgctctcagcatgccggacctggtgcatacagctgccggtgacggcgcgctggca
agtccgacgctgcgaagcactctgctggatcatcggaaggtttttctgagtattggtatt
ggcgtgttgttagtcggggcggtgcgagcttcacggcaggcggtgttaccgctttgggcc
gaagggctgggcctggatcctagtaccacctcgctgatttacggcctctccggagctatt
gacatgctggttttctaccccgcgggaaagttgatggatcgacgcggtcgcgcctgggtg
gcggtgccctcgatggtgttaatggggatttccctgctgctaatgccgctcactagcggg
gcattcggcttgcttttggtggcgctgctgatcggcttcggaaatggcatcggttcggga
gtggtgatgaccctgggagcggattattcgccggcgcgtggtcgcgcgcagttcctcggc
atttggcgctttttggccgatctcggggctttctcgggccccgccttgctttccggcatc
actgcgatactgagcctcagtgttggtattgcggctaccggactgatcggtctaggcgcg
gcggcggtgctttggtactggattccgcggacgccaaaaatttcagcctga

DBGET integrated database retrieval system