KEGG   Arthrobacter sp. IHBB 11108: UM93_16755Help
Entry
UM93_16755        CDS       T03775                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ari  Arthrobacter sp. IHBB 11108
Pathway
ari00020  Citrate cycle (TCA cycle)
ari00480  Glutathione metabolism
ari01100  Metabolic pathways
ari01110  Biosynthesis of secondary metabolites
ari01120  Microbial metabolism in diverse environments
ari01130  Biosynthesis of antibiotics
ari01200  Carbon metabolism
ari01210  2-Oxocarboxylic acid metabolism
ari01230  Biosynthesis of amino acids
Module
ari_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ari_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ari00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UM93_16755
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UM93_16755
Enzymes [BR:ari01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UM93_16755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AJT42709
UniProt: A0A0D4C2E0
LinkDB All DBs
Position
3555436..3556665
Genome map
AA seq 409 aa AA seqDB search
MAEAAKIKVVGPVVELDGDEMTRIIWQFIKDRLIHPYLDIDLRYYDLSIQNRDATDDQVT
VDAANAIKEHHVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNI
PRLVPGWNKPIIIGRHAFGDQYRATNFKVPGPGTLTLTFTPADGGEEIKQQVVTYPEEGG
VAMGMYNFNESIKDFARASFAYGLQRNYPVYLSTKNTILKAYDGQFKDLFQEVFDNEFKE
QFDAAGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMT
PDGKTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLMHRGKIDNTPEVVQFAE
TLEDVVIKTVESGKMTKDLALLVSPDQAFLTTEDFLAALDENLSARLAG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagcagcaaaaatcaaagtagtaggacccgtcgtcgagctcgacggcgacgag
atgacccgaatcatctggcagttcattaaagaccgtctgatccacccctatttggacatc
gacctgcgctactacgatctgtcgatccagaaccgtgacgccaccgatgatcaggtgacc
gttgacgccgctaatgcgatcaaggaacaccatgttggcgtcaagtgcgccaccatcact
ccggacgaagcccgggttgaagagttcggcctgaagaagatgtgggtctccccgaacggc
accatccgtaacattctcggcggtgtggtcttccgcgagccgatcatcatctccaatatt
ccccgcctggtgcccggctggaacaagccgatcatcattggccgtcacgctttcggcgac
cagtaccgcgccaccaacttcaaagttcccggccccggcacgctgaccctgaccttcacc
ccggctgacggcggcgaagagatcaagcagcaggtcgtcacctatcccgaagagggtggc
gtggcgatgggtatgtacaacttcaacgagtccatcaaggacttcgcccgggctagcttt
gcctacggtttgcagcgcaattacccggtttatctctccaccaagaacaccatcctgaag
gcctatgacggccagttcaaggatctcttccaagaggtcttcgacaatgagttcaaggag
cagttcgacgccgctggcctgacctacgagcaccggctgatcgacgatatggtcgcctcc
gcgatgaagtgggaaggcggctacgtctgggcttgcaagaactatgacggtgacgtgcag
tccgataccgtggcgcagggcttcggctcgctcggcttgatgacttcggtgctgatgacc
ccggacggtaagaccgttgaggctgaagcggcacacggcacggtgacccgtcactaccgt
cagcaccagcagggcaagcccacctcgaccaacccgattgcctcgatcttcgcttggacc
cgtggcctgatgcaccgcggcaagatcgataacacccccgaggtcgtgcagttcgccgag
accctggaagatgttgtcatcaagacggttgaatccggcaagatgacaaaggacttggcg
ctgctggttagcccagatcaggctttcttgaccaccgaggatttcctggctgcgctggat
gagaatctttcggcacgtttggctggctaa

DBGET integrated database retrieval system