KEGG   Acinetobacter radioresistens: DOM24_04230Help
Entry
DOM24_04230       CDS       T05620                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
arj  Acinetobacter radioresistens
Pathway
arj00020  Citrate cycle (TCA cycle)
arj00480  Glutathione metabolism
arj01100  Metabolic pathways
arj01110  Biosynthesis of secondary metabolites
arj01120  Microbial metabolism in diverse environments
arj01130  Biosynthesis of antibiotics
arj01200  Carbon metabolism
arj01210  2-Oxocarboxylic acid metabolism
arj01230  Biosynthesis of amino acids
Module
arj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
arj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:arj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DOM24_04230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DOM24_04230
Enzymes [BR:arj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DOM24_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AWV85810
UniProt: A0A2T1J3B9
LinkDB All DBs
Position
918455..920692
Genome map
AA seq 745 aa AA seqDB search
MAGGKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGVKVVKTDISVAARVLAEFSDYLSE
EQKVVDNLAELGRLTQDPDTNIIKLPNISASVAQLISCIKELQSKGYAIPDYPENPVTEE
EKAIKVRYSKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMGEWKPWSQTHVSHMQE
GDFYHGEKSMTLDRARNVKMELITKSGETIVLKPKVALQDGEIIDSMFMSKKALCDFYEK
ELDDCKEAGILFSLHVKATMMKVSHPIVFGHCVRIYYKDAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSVREEIIADLHACQEHRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
GGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWNGNFDPRTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLETGEVLMSQNVEKGDIWRMCQVKDAPIRDWVKLAVNRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKEGNDRAKLLARTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAQALAAQDEDAELKAKFAPLAQALAENEEKIIAELAQVQGQPADIGGYYA
IDQAKVNAVMRPSTTFNNVISSVAV
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggaaagtcaactatcatttacacactgactgacgaggcgccactgctggcg
acctattcgctactgccgatcattgagacctttactaagccggccggtgttaaagttgtt
aaaactgacatttctgtggctgcacgcgtgctcgctgaattctcggactacctcagtgaa
gagcagaaggtagtagacaatcttgcagagctaggtcgtcttacccaagatccagatact
aatattatcaagcttccaaatatcagtgcctctgttgcgcagttgatctcgtgtatcaaa
gagcttcaatcaaaaggttatgcaattccggattatccagaaaacccggtaaccgaagaa
gaaaaagcaattaaggtacgttatagtaaatgtttgggttctgcagtaaaccctgtacta
cgtgaaggtaactctgaccgtcgtgcaccagctgcagtcaaaaactatgcgaaaaaacac
ccgcactctatgggtgaatggaagccttggtcacaaacccatgtttcacatatgcaggaa
ggggacttctaccacggcgaaaagtcaatgacacttgaccgtgcgcgtaatgtaaaaatg
gaattgatcaccaagtctggtgaaactattgttctgaagccaaaagtagcgcttcaagat
ggcgaaatcatcgactcaatgttcatgagcaaaaaagcgctttgtgacttctatgaaaaa
gaattagatgattgtaaagaagctggcatcctgttctctttacacgtaaaagcgaccatg
atgaaagtatcacacccgatcgtattcggtcactgtgtgcgtatttactataaagatgca
tttgaaaagcacggtaaactgtttgacgagctaggcattaacgttaacaacggtatggct
ggtctttacgagaaaattgaaactttaccaacctctgtacgtgaagaaattattgctgac
ttgcatgcttgtcaagagcaccgtccagcgcttgcgatggttgattctgcaaaagggatc
actaacttccactcaccaaatgatgtcattgttgatgcttctatgccggcaatgatccgc
ggtggcggtaaaatgtggggtgctgatggcaaaccttatgactgtaaagcagtaatgcct
gaatcgacttttgcacgcatctatcaggaaatgattaatttctgtaagtggaatggtaat
ttcgatccacgtacgatgggtacggtacctaacgttggtctgatggcgcaaaaagctgaa
gaatacggttcacacgacaagacattcgagattcctgaagcgggcatcgcgaacatcact
gatcttgaaacgggtgaagtgctgatgtctcagaatgtggaaaaaggtgatatctggcgt
atgtgccaagtgaaagatgcgccaattcgtgactgggtaaaactggctgtaaatcgtgca
cgtaactcaggtatgccggctatcttctggcttgacccataccgtccacatgaaaatgag
ctgatcaagaaagtacagaaatacttaaaagatcatgatacgactggtctggatatccag
atcatgtctcaagtacgtgcaatgcgttatacgcttgagcgcgtagctcgcggtctcgat
actatttcagtaacaggtaatattttacgtgactacctgactgacctgttcccgattatg
gaactgggtacatcagcgaaaatgctgtctatcgtgccattaatggctggtggcggcatg
tatgaaacgggtgctggcggttctgcaccaaaacatgttcagcagttagttgaagaaaac
cacttacgctgggattctttaggtgaattcttggcactggcggtttctttagaagaaatg
ggaatcaaggaaggtaacgaccgtgccaagctgttagccagaacacttgatgaagctact
ggtaaactgctcgacaacgataaatctccatcacgtcgtactggtgaactggataaccgt
ggtagtcacttctatttatcactatattgggctcaggcacttgctgcacaggatgaagat
gctgaacttaaagcaaaatttgctccactggcccaagctttagctgaaaatgaagagaag
attattgccgagcttgcgcaagtgcagggtcaaccagctgatattggtggctattacgct
attgatcaggcaaaagtaaatgcggtaatgcgtccaagtaccacattcaataatgtaatt
tcgagcgttgctgtttaa

DBGET integrated database retrieval system