KEGG   Acinetobacter radioresistens: DOM24_04440Help
Entry
DOM24_04440       CDS       T05620                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
arj  Acinetobacter radioresistens
Pathway
arj00550  Peptidoglycan biosynthesis
arj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DOM24_04440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:arj01002]
    DOM24_04440
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arj01011]
    DOM24_04440
Enzymes [BR:arj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DOM24_04440
Peptidases and inhibitors [BR:arj01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DOM24_04440
Peptidoglycan biosynthesis and degradation proteins [BR:arj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DOM24_04440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AWV85848
LinkDB All DBs
Position
complement(969978..971126)
Genome map
AA seq 382 aa AA seqDB search
MTRKSAIAALLLLPSFSYAATVLSSPPELNNKSYVLMDYETGQILAAKNENEKLAPASMT
KMMTSYIIEQKLLKGELTENEQVRMNESAWCRGSSSESCMYVPLNGTASVLEMLRGIIVQ
SGNDASKAVAEHVAGNEGTFAHMMNQEAKRIGMVNTHFVNSTGMPAEGHVSTAKDMAILA
QHIIKDSSKYYPIYSEKEFTFNGIKQGNRNALLYTDPSVDGLKTGHTDEAGFCLTTSSKR
GPMRLISVIFGAPTMQERATQTRDLLGWGYANFETASVQPAKQVLAKSKVWFGQENEVEV
GLAENFNVTMPKGQADKIKTQLVVQPKLNAPLQKGQVVGKLVASLDGKVIAEKPLVALKS
VEEAGFFSRMIDHIKQFFSNLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaaaaagtgccattgctgccctactcttgttaccgtctttctcatatgcagca
acagtcctctcttctccaccagaattgaataataaatcctatgttctgatggactatgag
accgggcaaatcctggctgcaaaaaatgaaaatgaaaagctggcacctgcctcaatgact
aaaatgatgaccagctacatcattgagcaaaaattattaaaaggtgaactcaccgaaaac
gaacaggttcgtatgaacgagtcagcctggtgccggggaagcagttctgaatcatgtatg
tacgttcctttaaatggaacagcctctgtcctagaaatgctgcgaggtatcatcgtacaa
tctggtaatgacgcatcaaaggccgtggctgaacacgtagctgggaatgaaggtacattc
gcccatatgatgaatcaggaagcaaaacgtattggcatggtaaatacccatttcgttaac
tcgacaggtatgccagctgaaggtcatgtttctacggccaaagatatggccatacttgca
cagcacatcattaaagacagctctaaatattatccgatctattcagaaaaagaatttacc
tttaacggtatcaaacagggtaaccgtaatgccctgctttatactgacccaagtgtggac
ggcttgaaaacaggacacactgatgaagctggcttctgtctgactacttcatcaaaacgt
ggtccaatgcgactaatttcagtaatctttggtgcgccaaccatgcaggaacgcgcaact
cagacccgtgatctgctgggatggggttatgccaactttgaaactgccagtgtacaacct
gcaaaacaggttctggctaaatcaaaagtctggtttggtcaggaaaatgaggttgaagta
ggtcttgccgagaactttaacgtgactatgccaaaaggtcaggccgacaaaattaaaacc
cagctggtggttcagcctaaactaaatgctcccctgcaaaaaggccaagtagtaggtaaa
ctggtggctagcctagatggtaaagttattgcagaaaagccattagtcgcattaaaatcg
gtagaagaagcaggtttcttttcacgtatgatcgaccatattaaacagttctttagcaac
ttgttctaa

DBGET integrated database retrieval system