KEGG   Acinetobacter radioresistens: DOM24_04675
Entry
DOM24_04675       CDS       T05620                                 

Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
arj  Acinetobacter radioresistens
Brite
KEGG Orthology (KO) [BR:arj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:arj03009]
    DOM24_04675
Enzymes [BR:arj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     DOM24_04675
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     DOM24_04675
Ribosome biogenesis [BR:arj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DOM24_04675
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 MTS N6_Mtase Methyltransf_31
Other DBs
NCBI-ProteinID: AWV85894
LinkDB
Position
complement(1023029..1025233)
AA seq 734 aa
MNASQRLSTYWVTCADGLELLLEEEIAQLGASNVERKPGRLVFQGSLETAYRICMWSRLA
SRVLLPIHTQEIEFSHDARDVAEELYDGALSFDWSLIFAPQSTFAIRLHVERDIKVNTQF
ATLRVKDGVVDAFMEAVGRRPSIDTKQPEITLYVLAGKTEHSYCLDLSGDSLHKRGYRHY
MTDAPIKENLAAAILHKAGIEKRKPDIILDPMCGSGTFIIESLMILTDRAPGLVRRFGFN
GWHGHDRELWMSLKAEAVERHEQALEQPLPKFYAFDADWEAVKATRQNIAAAGFEKQLEQ
IQVEERTLADWPEFDAAEKTAFIVTNPPYGERLGEKASNRALYLGLSGQLQKHFPNQYAA
VIAAQVEQADVLAFEHPETLRLMNGKLPIYIRFGTIKPASDNVPFLEKWQLQNVEIEGAQ
DFANRLQKNMQTLKKWATKDRVFCLRLYDADLPDFNVAVDLYGDRLHVQEYAPPKTIDPE
KAKKRFNLALAAIRTVTGLGRDAIFIKTRARQAGKAQYEKQSTASKRFIVQEGQARILVN
LTDYLDTGLFLDHRQMRLRIAREAKGKHFLNLYSYTSTASLHAALGGAASTTSVDLSNTY
LNWSKENFVLNGLTVDHPDQQHQFFASDCFEWLKEGHEQYDMIFIDPPTFSNSKKFYGTF
DVQRDHVSLLKRAMNRLTTEGTLYFSNNYRGFEMDEEIEAMFDIEEITQETIGPDFKRNQ
KIHRAWKIQHYPVN
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaatgcatcgcaacgtttatctacttattgggtcacctgtgctgatggtttggagctc
ttgcttgaagaggaaatcgcacaactcggtgcgtcaaatgtagaacgcaaaccaggccgg
ttagtttttcaaggttctctggagactgcttaccgtatctgtatgtggtcacgtctggcc
tcacgcgtattgttacccattcatacccaggaaatcgagtttagtcatgatgcccgcgat
gtggctgaagaactgtatgatggtgcgcttagctttgactggtcacttatttttgcacct
caaagtacttttgctatccgtctgcatgtagagcgtgatattaaggtcaatacccagttt
gccaccttacgtgtcaaggatggggtagtcgatgcatttatggaagcagtgggccgccgt
cctagtattgatacaaagcaaccagaaattaccttatacgtattggctggtaaaactgaa
catagttattgtctggatttatccggagattccctgcataaacgcggctatcgtcactat
atgaccgatgcaccgattaaagagaatctggcagcagcaatattacataaggctggtatt
gaaaaaagaaagccggatattattttagatccaatgtgcggttcaggtacgtttattatt
gagtctctcatgattctgactgaccgggctccgggcctggtacgccgttttggctttaat
ggctggcatggtcatgaccgtgaattatggatgtcccttaaagccgaagcagtagaacgc
cacgagcaggcacttgaacagcctttacctaaattttatgcttttgatgcagactgggaa
gcggttaaagctacccgccagaatattgctgccgccggattcgagaaacagctggaacag
attcaggtagaagaacgtacacttgctgactggcctgaattcgatgcagctgaaaaaact
gcatttattgtcaccaatcccccatatggcgaacgtttaggcgagaaagcttctaaccgg
gcactttatctcggtttatctggccagttacaaaaacactttcctaaccaatatgcagca
gtaattgcggcacaagtagaacaggcagatgttctggcatttgagcatcctgaaactcta
cgcctaatgaatggtaaactgccaatttatattcgttttggaactatcaaacctgcatcc
gataacgtacctttcttagaaaaatggcagcttcaaaatgtagaaattgaaggtgctcaa
gattttgctaatcgattgcaaaaaaatatgcaaaccttgaaaaaatgggcaaccaaggat
cgtgtgttctgcctgcgtctttatgatgcagatctgcctgattttaacgttgcagttgac
ttgtacggtgaccgtttgcatgtgcaggaatatgctccaccaaaaacgattgatccggag
aaagccaagaaacgttttaatttggcacttgccgctatccggacagtgacgggcctgggg
cgtgatgcaatatttattaaaactcgtgcccgtcaagcaggtaaagcacagtatgaaaag
cagagtacggcgtccaaacggtttattgttcaggaaggacaagccagaattttagtgaac
ctgacagattatctagataccggactgtttctcgaccaccgtcaaatgcgcctacgtatt
gcccgtgaagctaaaggtaaacacttcctgaatctgtacagttatacttctacagccagc
ctgcatgctgcactcggcggtgcagccagtacaaccagtgtagacctgtcaaatacctac
ttaaactggtctaaagaaaattttgttttaaacggattaactgttgaccatcctgaccag
cagcaccagttctttgccagtgactgttttgagtggctaaaagaaggccatgaacagtat
gatatgatttttattgatccgcccactttctcaaactcgaaaaagttctacggaaccttt
gatgtacaacgtgaccatgtttcattacttaaacgtgccatgaaccgtctcacaaccgaa
ggtacgctttatttttcaaataactaccgcggtttcgagatggatgaagaaattgaagcc
atgtttgatattgaagaaatcactcaggagactatcgggccggatttcaaacgcaatcag
aaaatccaccgtgcctggaaaatccagcattatccagtaaattaa

DBGET integrated database retrieval system