KEGG   Arachidicoccus sp. KIS59-12: D6B99_00845Help
Entry
D6B99_00845       CDS       T05648                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ark  Arachidicoccus sp. KIS59-12
Pathway
ark00473  D-Alanine metabolism
ark01100  Metabolic pathways
ark01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ark00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D6B99_00845
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D6B99_00845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ark01011]
    D6B99_00845
Enzymes [BR:ark01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D6B99_00845
Peptidoglycan biosynthesis and degradation proteins [BR:ark01011]
 Precursor biosynthesis
  Racemase
   D6B99_00845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AYD46292
UniProt: A0A386HKW6
LinkDB All DBs
Position
177638..180088
Genome map
AA seq 816 aa AA seqDB search
MYTINRIASIVDASSVLANKEAAIEYLITDSRKVTFAASSLFFTLKTEHRNALVFLDDLY
QQGVRNFVVQEEIDFSKYKDANFLVVKNSLKALQKLAQFHRLQFHYPVMGITGSNGKTIV
KEWLNFLLSDSYKIVRSPRSYNSQIGVPLSIWQMNAENDLGIFEAGISERNEMDALRKII
QPTIGILTNIGDAHDKGFESRKQKLQEKLRLFQHSKIVFANADDENIKASIGEVLNTDIF
SFGKNKNATLHITAVKKEQNKTVIEGVFENNTLHITIPFLDEASVQNALICWAVALYFKV
SESVIMEKMAQLPAIDMRLQVLPAINGCTVINDSYSLDIDSLSVGLDLLNQQLLSKTVIL
SDVHEAEERTYIQILDILHHKKISRLIAIGKFWESLKPFMGSKIPIIETYNSTFDFVQQF
HAGQFKNESILLKGARLFRFEDILNLLVEKVHQTRLEINLSNIVHNFKTYKKRLQPSTKM
MAMVKAFAYGSGSVEIASILQYHKIDYLAVAYADEGVELRNAGINLPIMVMNIDEYGFEA
MLQHNLEPEIYSFKILKEFTVFVQKQAVAQYPVHLKLDTGMHRLGFEEGEIDRLMDELKV
NKSLVIKSVFSHLSSSEDAADDNFTILQAEIFRRCCDKIQNVVHYNFIRHLANSAGIARH
PDLQFDMVRLGIGLYGVDTTDKGLALKNVATLKSTIAQIKHLQPNETVGYNRMGKISQPT
TTATIRIGYADGYSRKLSNGVGFVLINNHQAPVIGNVCMDMTMVDITHIDNVNEGDEVEV
FGVDLPVENIAKWSDTNVYEIFTSVGQRVKRVYVEE
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccattaatagaatagcttcaattgtagatgcatcgagtgttctagctaataaa
gaagctgcgattgaatacttaattactgacagccgtaaagtaacttttgcggcttcgtct
ttattttttacgctcaaaactgagcatagaaatgcattagtttttttggatgacttgtac
cagcaaggggttagaaattttgtagttcaagaagaaattgacttttcaaaatataaggat
gccaatttcttagtcgtaaaaaactccttgaaggctttgcaaaaattggcacagtttcat
cgtttgcaattccattatcccgttatgggtattactggaagcaatggcaaaacgatagta
aaagaatggttgaatttcttgttgagtgattcttataaaattgtgcgtagcccccgcagt
tataattctcaaatcggtgtaccacttagtatttggcagatgaatgccgaaaatgatctt
ggtatttttgaggccggtatttctgaaaggaatgaaatggatgcattaaggaaaattata
caacctacgattgggattcttacaaatattggggatgctcatgataaaggctttgagagc
agaaagcagaaattacaggagaaactaaggttgtttcagcattcaaaaattgtttttgcc
aatgccgatgatgaaaatattaaagcctctattggagaggttttgaatacagatattttt
tcttttggtaaaaataaaaatgctacacttcatattacagccgttaaaaaagaacaaaac
aaaacggttattgagggtgtctttgagaacaataccttacatattacaattccattcctt
gacgaagcttctgtgcaaaatgcgcttatttgctgggctgtggcactttattttaaagtg
agcgaaagcgttattatggaaaagatggcgcaattacctgcaatagatatgcgtttacag
gtgcttcccgcaattaatggatgtacggttatcaacgatagttacagcttggatattgac
tctttatctgttgggctggatctgctaaatcaacagttattgtcaaagacagttatttta
tctgatgtacacgaggcagaagaaagaacttatatacagattttagatatattgcaccat
aaaaaaattagccgcttaattgctatcggcaagttctgggagtcattaaaaccatttatg
ggtagtaaaatccctattattgagacctacaatagtacatttgattttgtgcaacaattt
catgctgggcaatttaaaaatgaatctattttgttaaagggtgcacggttgtttcgtttt
gaagatatcttaaatctgttggtagagaaagtacatcaaacaagattggagattaacctt
tctaatattgttcacaattttaagacctataaaaagcgtttacaaccttcaactaaaatg
atggcgatggtaaaagcctttgcctatggaagtggaagtgtagagatagctagtatatta
caatatcacaagattgactatctcgcagtggcatatgctgatgaaggtgttgaattgcgc
aatgcgggaattaatcttccaatcatggtcatgaatatagatgaatatggttttgaagcc
atgttgcagcacaatttagagcctgaaatttattcgtttaagattttgaaagagtttact
gtatttgttcaaaaacaagctgtagcgcagtatcctgtgcatttgaaattagatacaggc
atgcatcgtttgggttttgaagagggggaaattgatagattgatggatgaattgaaggtg
aataaatcacttgtgataaaatctgtttttagtcatcttagttctagtgaggatgcagct
gatgataattttaccatactacaagcagaaattttccggcgctgttgtgataaaatccaa
aatgttgtacactataattttataagacatctagctaattccgcgggaattgcgcggcac
ccagatttgcaatttgatatggtgcgtttaggtatcggactgtacggtgtagatacaact
gataaaggattggcattaaaaaatgtggctactttaaaatctaccattgcacaaatcaag
cacttacaacccaatgaaactgttggctataacagaatgggtaagatttcgcaaccaacg
accacggccactattcgtattggttatgcggatggttacagtagaaagctaagtaatggc
gtgggttttgttttaatcaacaatcatcaagcacctgtaattgggaatgtatgtatggat
atgacaatggtggatattacccatattgacaatgtaaatgaaggagatgaagtagaagtt
tttggagtagatttacctgtggaaaatattgctaaatggagtgatacaaatgtttacgag
atatttacttcagtggggcaaagagtaaaaagggtgtatgttgaagaatag

DBGET integrated database retrieval system