KEGG   Arachidicoccus sp. KIS59-12: D6B99_14620Help
Entry
D6B99_14620       CDS       T05648                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
ark  Arachidicoccus sp. KIS59-12
Pathway
ark01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ark00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    D6B99_14620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ark01004]
    D6B99_14620
Enzymes [BR:ark01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     D6B99_14620
Lipid biosynthesis proteins [BR:ark01004]
 Desaturase
  Front-end
   D6B99_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF4191 DUF2207 CRCB
Motif
Other DBs
NCBI-ProteinID: AYD48729
UniProt: A0A386HST8
LinkDB All DBs
Position
3499875..3500948
Genome map
AA seq 357 aa AA seqDB search
MSTPKFAKSATSFHVELKHRINEYFRTTGKSNTGGIRIYSKALFLALSLIYCYIQVVFFT
PENTWVNVLLCILIGALVSGIGFNVMHDGGHGSFSKWSAMNKIAAYSAEVVGASQFMWNM
KHNVIHHAYTNIDGVDDDIDAKPFLRMASTQKKYKMHKFQHLYFWMFYAILHIYWTLLSD
YRKYFTGKIGSTPLKKMKRKDHIMFWSFKAFYYCLFIVIPIVKLGFSKWIIGYLIFSFTA
GFILSIVFQLAHTVEDTSFPIPNELTGKLEDEWAIHQLKTTANFATGNKFISWYVGGLNF
QVEHHLFPKISHVHYPAINKIVKQACKEYNVTYIEYKRMYQAIYSHVSFLKHMGHIA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacctaaatttgcaaaatctgcgacatcgtttcacgtagaattaaagcataga
ataaacgaatattttcgtactactggaaagtccaatactggtgggatacgtatctattct
aaagcattatttcttgcactttccttaatttattgttatatacaggttgtgttttttaca
cctgagaacacttgggttaatgtattattatgcatactaattggggctttagtatccggg
atcggattcaatgtaatgcatgatggaggacatggtagtttcagcaaatggagtgcaatg
aacaaaatagcagcctattctgcggaagtagttggcgcaagccaatttatgtggaatatg
aagcacaatgttattcatcatgcttatacaaatattgacggcgttgatgatgatattgat
gcgaagccatttttacgtatggcatctacacaaaagaaatacaaaatgcacaagtttcag
catttatacttttggatgttttatgccattttacatatctattggacattactaagtgat
tatcgaaaatattttacaggtaaaataggctccactcctctaaagaagatgaagcgcaaa
gatcatataatgttttggagttttaaagcattttattattgcctattcattgtgataccg
attgttaagctgggtttctctaaatggattatcggctacctaatttttagttttactgct
ggctttattttaagtattgtatttcagttggcacatactgttgaagatacttcttttccg
attccaaatgagcttaccggcaaattagaggacgaatgggccattcatcaacttaaaacg
accgcaaactttgcgaccggtaataaatttatttcctggtatgtaggcgggttaaatttt
caggtagagcatcatttgttcccgaaaatatctcatgtgcattaccctgcaattaataaa
atagtcaaacaagcctgcaaagaatataatgttacttatattgaatataaacgtatgtat
caagcaatctattcacatgtaagcttcttaaaacatatggggcatattgcgtaa

DBGET integrated database retrieval system