KEGG   Arthrobacter sp. LS16: AFL94_01690Help
Entry
AFL94_01690       CDS       T04078                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00473  D-Alanine metabolism
arl01100  Metabolic pathways
arl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFL94_01690
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AFL94_01690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arl01011]
    AFL94_01690
Enzymes [BR:arl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AFL94_01690
Peptidoglycan biosynthesis and degradation proteins [BR:arl01011]
 Precursor biosynthesis
  Racemase
   AFL94_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALD62878
LinkDB All DBs
Position
358588..359790
Genome map
AA seq 400 aa AA seqDB search
MPSPTIFLDPAARIDTANPQRSALIDLGAISGNVETLRGIAGTAKLMAVLKADGYGHGLV
PAARAALRGGADYLGTAVLEEAFALRAAGVDAPIFTWLNAPGSNYLRAIEEDIDLAAYDC
AQLEEICQAARQAGRPARVHLKIDTGMWRGGASAEDWPRLCGAARRALDAGLIEATGIWS
HLAAADEPENPSTSMQLAAFRAALAVARDLGITPRLRHIANSAATLSNPEAHFDLVRPGI
SVYGINPLPPECRTSRMDLRPAMTLRAAVAHVKAAPAGAAVSYGGTERAAAATQLAIIPL
GYADGVMRSASSKGPVQIGAGRYRVIGRVCMDQFMVQVGSDAVVPGQQALLFGPGTDGEP
HLDQWAQAADTIPYEILTRIGTRVPRIYLESIPAPDVSGT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtcccacgattttcctcgacccggcggcccggatcgacaccgcgaacccgcag
cgcagcgcgctgatcgacctcggagccatcagcggcaatgttgaaacgctgcgcgggatt
gcgggcaccgcgaagctgatggcggtgctcaaggccgacggctacggccacgggctggtc
ccggcagcccgcgcggccctgcgcgggggcgcggactacctgggcaccgccgtcctggag
gaggccttcgccttgcgcgccgcaggagtcgatgccccgatcttcacttggctcaatgcg
cccgggagcaactacctccgggccatcgaggaagatatcgatctggcagcctacgactgc
gcccagctcgaggagatctgccaggcggcccggcaggccgggcggcccgcgcgcgtccac
ctgaagatcgacaccggcatgtggcggggcggggcaagtgccgaggactggccccggctg
tgcggcgcggcgcggcgcgccctggacgccgggctgatcgaggccaccggcatctggtcg
cacctggccgcggccgacgaaccggagaacccgtcgacctcgatgcagctggcggcattc
cgcgccgcgctcgccgtggcccgggacctcggaatcaccccgagactgcgccacatcgcc
aactcggcggccacgctcagcaacccggaagcccacttcgacctggtgcggcccgggatc
tccgtctacggcatcaacccgctgccgcccgaatgccgcacctcccggatggacctgcgc
ccggccatgaccctgcgcgcggccgtcgcgcatgtgaaagctgcccccgccggcgccgcg
gtgagctacgggggaactgaacgcgcggcggccgccacccagctggccatcatccccctc
gggtacgccgacggggtgatgcgcagcgccagcagcaagggaccggtgcagatcggcgcc
gggaggtaccgggtgatcgggcgcgtgtgcatggaccagttcatggtccaggtcggttcg
gacgccgtggtgccgggccagcaggccctgcttttcgggccgggaaccgacggggagccg
cacctggaccagtgggcccaggccgcggacacgatcccgtacgaaatcctgacccgcatc
ggaactcgggtgcccaggatctatctcgagtcgattcccgccccggacgtttctggtacc
taa

DBGET integrated database retrieval system