KEGG   Arthrobacter sp. LS16: AFL94_09420Help
Entry
AFL94_09420       CDS       T04078                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00020  Citrate cycle (TCA cycle)
arl00190  Oxidative phosphorylation
arl00650  Butanoate metabolism
arl01100  Metabolic pathways
arl01110  Biosynthesis of secondary metabolites
arl01120  Microbial metabolism in diverse environments
arl01130  Biosynthesis of antibiotics
arl01200  Carbon metabolism
Module
arl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
arl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
arl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:arl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFL94_09420
   00650 Butanoate metabolism
    AFL94_09420
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AFL94_09420
Enzymes [BR:arl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AFL94_09420
    1.3.5.4  fumarate reductase (quinol)
     AFL94_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 HI0933_like DAO Thi4 Pyr_redox_3 NAD_binding_8 GIDA Pyr_redox ApbA FAD_oxidored Zwint
Motif
Other DBs
NCBI-ProteinID: ALD65679
LinkDB All DBs
Position
complement(2061094..2062821)
Genome map
AA seq 575 aa AA seqDB search
MKPEQQISTSVLVIGTGGSGLRAAIELAEQGVDVLAVGKRPRHDAHTSLAAGGINAALGT
MDEEDSWQQHAADTIKESYFLADPRTVQVVAQGAARGIEDLERYGMNFAREVDGRISQRF
FGAHTFRRTAFAGDYTGLEIQRTLIKRAEQLQVPILDTVYITELLTAEGQIFGAYGFDVN
HGTGYLIHADAVILAAGGHNRIWRRSSSRRDENTGDSFRLAVQAGARLRDPELVQFHPSG
IIEPESDAGTLVSEAARGEGGILTNALGERFMARYDAKRMELSTRDRVALAAYTEIREGR
GTENGGVWLDVSHLDREVIMKRLPRVYQTMMELQMLDITQQKMEIAPTAHYSMGGVWVDP
LTHATEVPGLYAIGEASSGLHGANRLGGNSLIELLVFGRIVGQHAAQYSASLASQPRSAQ
AIAAARAHIAELLGSRGQENVRNLQRAIRDLMTEHAGVVRDEAGLLEGLAKLQAIEQRMA
NVGIHPDIAGYQDLAHAFDLQSSALAARATLEAALERRETRGCHNRSDYPAMDPALQVNL
VWSPSTGITREPIPEVPAQIAELITEVSQEGKLVE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagaacagcagatatccacgtcagtcctcgtcatcggcaccggaggatccggc
ctgcgcgccgcgatcgaattggccgagcagggcgtcgacgtgttggcggtgggcaagcgc
ccgcgccacgacgcgcacacctccctggccgccggcggcatcaatgcggcgctgggcact
atggacgaggaagacagctggcagcagcacgcggccgacaccatcaaggaaagctacttc
ctggccgacccgcgcaccgtgcaggtggtcgcccagggcgccgcccgcggcatcgaggac
cttgaacgctatgggatgaacttcgcccgcgaggtggacggccgcatctcgcagcgcttc
ttcggcgcccacaccttccgccgtaccgccttcgccggggactacaccggcctggagatc
cagcgcacgctgatcaagcgggccgagcagctgcaggtgccgatcctcgacaccgtgtac
atcaccgagctgctcaccgccgaagggcagatcttcggcgcctacggcttcgacgtgaac
cacggcaccggctatctcattcacgccgatgcggtgatcctggccgctggcgggcacaac
cgcatctggcgccgcagcagctcgcgccgcgacgagaacaccggcgactcgttccgcctg
gccgtccaggccggcgcccggctgcgcgaccccgagctggtgcagttccatccctcgggc
atcatcgaaccggaaagcgacgccggaaccctggtctccgaggccgcgcgcggcgaaggc
ggaatcctgaccaatgcgctgggcgaacgcttcatggcccgctacgacgccaagcgcatg
gagctgtccactcgcgaccgggtcgcgctggccgcctacaccgagatccgcgagggacgc
ggcaccgagaacggcggggtgtggctggacgtctcgcaccttgaccgcgaggtcatcatg
aagcgcctgccgcgggtctaccagaccatgatggaactgcagatgctggacatcacccag
cagaagatggagatcgcaccgaccgcgcactactccatgggcggggtctgggtggacccg
ctgacccatgccaccgaggttcccgggctctacgccatcggcgaggcctcctccggactg
cacggggccaaccggctgggcggcaactcgctgatcgagctgctggtcttcgggcgcatc
gtgggacagcacgcggcgcagtactccgcgtcgctggcctcccagccgcgctcggcgcag
gccatcgccgccgcccgcgcccacatcgcagagctgctcggatcccgcggacaggaaaac
gtgcgcaacttgcagcgcgccatccgcgacctgatgaccgagcacgccggggtggtgcgc
gacgaggccgggctgctggaaggcctggcgaagcttcaggccatcgagcagcgcatggcc
aacgtgggaatccacccggacatcgccggctaccaggacctggcccacgccttcgacctg
cagtcctcggcgctggccgcccgcgccacgctggaagcagcgctggaacgccgcgaaacc
cgcggctgccacaaccgcagcgactacccggccatggatccggcgctgcaggtgaacctg
gtctggtcgccgagcaccgggatcacccgcgaaccgattcccgaagttccggcgcagatc
gcggaactgatcaccgaggtgtcccaggaaggcaaactcgtggagtaa

DBGET integrated database retrieval system