KEGG   Arthrobacter sp. LS16: AFL94_11715Help
Entry
AFL94_11715       CDS       T04078                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00220  Arginine biosynthesis
arl00250  Alanine, aspartate and glutamate metabolism
arl00290  Valine, leucine and isoleucine biosynthesis
arl01100  Metabolic pathways
arl01110  Biosynthesis of secondary metabolites
arl01130  Biosynthesis of antibiotics
arl01210  2-Oxocarboxylic acid metabolism
arl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFL94_11715
   00290 Valine, leucine and isoleucine biosynthesis
    AFL94_11715
   00220 Arginine biosynthesis
    AFL94_11715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arl01007]
    AFL94_11715
Enzymes [BR:arl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AFL94_11715
    2.6.1.66  valine---pyruvate transaminase
     AFL94_11715
Amino acid related enzymes [BR:arl01007]
 Aminotransferase (transaminase)
  Class I
   AFL94_11715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Costars
Motif
Other DBs
NCBI-ProteinID: ALD64468
LinkDB All DBs
Position
complement(2544136..2545356)
Genome map
AA seq 406 aa AA seqDB search
MAEFKQSTKLHNVLYDIRGPLLEHATRMEAEGHRILKLNIGNPAPFGFEAPDAVLVDMIR
NLPNAQGYSDSRGILSARTAVSQYYQTRGIQTIGVDDIYLGNGVSELITLSLNALLNNGD
EVLIPAPDYPLWTASVSLAGGTPVHYLNVEEEGWLPDLEDMEAKITDRTKGIVIINPNNP
TGAVYPKETLEGILELARKHDLIVFSDEIYEKILYDDAEHINTAGLADDVLVITFSGLSK
AYRVCGFRAGWMAISGPRHLAADYIEGINLLTNMRLCANVPAQHAIQTALGGYQSINDLI
LPGGRLLEQRDAAYNLLTAIPGVSVQKAKGALYMFPKLDPEVYPIHDDEKFALELLKAQK
ILISQGTAFNWVRPDHFRLVTLPNVRDLTDAVGRIGTFLEDWRARA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcaaacaatcgacgaaactgcacaacgtcctctacgacatccgcggaccg
ctgctggagcacgccacccgcatggaggccgagggccaccgcatcctgaagctgaacatc
ggcaatcccgcgccgttcggcttcgaagcgcccgacgcggtgctcgtcgacatgattcgc
aacctgcccaacgcccagggctactccgactcgcgcggcatcctctccgcccggaccgcg
gtctcgcagtactaccagacccgcggcatccagaccatcggcgtggacgacatctacctg
ggcaacggcgtctccgagctgatcaccctgagcctgaacgcgctgctgaacaacggcgac
gaggtgctgatcccggctcccgactacccgttgtggaccgcctcggtctcgctggccggc
ggcaccccggtgcactacctcaacgtggaggaggagggctggcttcctgacctggaggac
atggaagcgaagatcaccgaccgcaccaagggcatcgtgatcatcaacccgaacaacccc
accggcgccgtctacccgaaggagaccctggaggggatcctggaactggcccgcaagcac
gatctgatcgtcttctccgacgagatctacgagaagatcctctacgacgacgccgagcac
atcaacaccgccggcctggccgacgacgtgctggtcatcaccttctccgggctgtccaag
gcctaccgggtctgcggcttccgcgccggctggatggccatttccggtccgcgccacctg
gccgctgactacatcgagggcatcaacctgctgaccaacatgcgcctgtgcgccaatgtg
ccggcgcagcatgcaatccagaccgcgctgggcggctaccagtcgatcaacgacctgatc
ctgcccggcggccgcctgctggagcagcgcgacgcggcctacaacctgctcaccgccatc
cccggcgtgagcgtgcagaaggccaaaggtgcgctctacatgttcccgaagctggatccc
gaggtctacccgatccacgacgacgagaagttcgccctggagctgctcaaggcgcagaag
atcctgatctcccagggcaccgcgttcaactgggtgcgccctgaccacttccgcctggtc
acgcttccgaacgtgcgcgacctgaccgatgcggtcggccgcatcggtaccttccttgag
gactggcgcgcccgggcataa

DBGET integrated database retrieval system