KEGG   Arthrobacter sp. LS16: AFL94_11715Help
Entry
AFL94_11715       CDS       T04078                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00220  Arginine biosynthesis
arl00290  Valine, leucine and isoleucine biosynthesis
arl01100  Metabolic pathways
arl01110  Biosynthesis of secondary metabolites
arl01130  Biosynthesis of antibiotics
arl01210  2-Oxocarboxylic acid metabolism
arl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFL94_11715
   00290 Valine, leucine and isoleucine biosynthesis
    AFL94_11715
   00220 Arginine biosynthesis
    AFL94_11715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arl01007]
    AFL94_11715
Enzymes [BR:arl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AFL94_11715
    2.6.1.66  valine---pyruvate transaminase
     AFL94_11715
Amino acid related enzymes [BR:arl01007]
 Aminotransferase (transaminase)
  Class I
   AFL94_11715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Costars
Motif
Other DBs
NCBI-ProteinID: ALD64468
LinkDB All DBs
Position
complement(2544136..2545356)
Genome map
AA seq 406 aa AA seqDB search
MAEFKQSTKLHNVLYDIRGPLLEHATRMEAEGHRILKLNIGNPAPFGFEAPDAVLVDMIR
NLPNAQGYSDSRGILSARTAVSQYYQTRGIQTIGVDDIYLGNGVSELITLSLNALLNNGD
EVLIPAPDYPLWTASVSLAGGTPVHYLNVEEEGWLPDLEDMEAKITDRTKGIVIINPNNP
TGAVYPKETLEGILELARKHDLIVFSDEIYEKILYDDAEHINTAGLADDVLVITFSGLSK
AYRVCGFRAGWMAISGPRHLAADYIEGINLLTNMRLCANVPAQHAIQTALGGYQSINDLI
LPGGRLLEQRDAAYNLLTAIPGVSVQKAKGALYMFPKLDPEVYPIHDDEKFALELLKAQK
ILISQGTAFNWVRPDHFRLVTLPNVRDLTDAVGRIGTFLEDWRARA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcaaacaatcgacgaaactgcacaacgtcctctacgacatccgcggaccg
ctgctggagcacgccacccgcatggaggccgagggccaccgcatcctgaagctgaacatc
ggcaatcccgcgccgttcggcttcgaagcgcccgacgcggtgctcgtcgacatgattcgc
aacctgcccaacgcccagggctactccgactcgcgcggcatcctctccgcccggaccgcg
gtctcgcagtactaccagacccgcggcatccagaccatcggcgtggacgacatctacctg
ggcaacggcgtctccgagctgatcaccctgagcctgaacgcgctgctgaacaacggcgac
gaggtgctgatcccggctcccgactacccgttgtggaccgcctcggtctcgctggccggc
ggcaccccggtgcactacctcaacgtggaggaggagggctggcttcctgacctggaggac
atggaagcgaagatcaccgaccgcaccaagggcatcgtgatcatcaacccgaacaacccc
accggcgccgtctacccgaaggagaccctggaggggatcctggaactggcccgcaagcac
gatctgatcgtcttctccgacgagatctacgagaagatcctctacgacgacgccgagcac
atcaacaccgccggcctggccgacgacgtgctggtcatcaccttctccgggctgtccaag
gcctaccgggtctgcggcttccgcgccggctggatggccatttccggtccgcgccacctg
gccgctgactacatcgagggcatcaacctgctgaccaacatgcgcctgtgcgccaatgtg
ccggcgcagcatgcaatccagaccgcgctgggcggctaccagtcgatcaacgacctgatc
ctgcccggcggccgcctgctggagcagcgcgacgcggcctacaacctgctcaccgccatc
cccggcgtgagcgtgcagaaggccaaaggtgcgctctacatgttcccgaagctggatccc
gaggtctacccgatccacgacgacgagaagttcgccctggagctgctcaaggcgcagaag
atcctgatctcccagggcaccgcgttcaactgggtgcgccctgaccacttccgcctggtc
acgcttccgaacgtgcgcgacctgaccgatgcggtcggccgcatcggtaccttccttgag
gactggcgcgcccgggcataa

DBGET integrated database retrieval system