KEGG   Arthrobacter sp. LS16: AFL94_15560Help
Entry
AFL94_15560       CDS       T04078                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:arl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AFL94_15560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:arl03400]
    AFL94_15560
Enzymes [BR:arl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFL94_15560
DNA repair and recombination proteins [BR:arl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AFL94_15560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ALD65105
LinkDB All DBs
Position
3357927..3360383
Genome map
AA seq 818 aa AA seqDB search
MARREQTVTVDGRTLKVSNLDKVLYPETGTTKGEVIDYLQRVAPALLPHAAWRPATRKRW
VDGVGTARNPGTVFFRKDLEDSAPSWIPRARLEHKTHSNTYPLANDAAVLAWFGQVAALE
IHVPQWRFNASLEQQHPDRLVLDLDPGPGAGLAQCAEVALLCREILEGMDLRPFPVTSGS
KGIHLYAGLDGTATSDQVNEVAKELAASLERKHPRLVVANMKKSLRENKVLVDWSQNNAA
KTTVCPYSLRGRSRPMVAAPRSWEEIESPGLEHLDFHEVLDRLSDGLDPLAALAPLAEQG
TDRLAVYRSKRDAKLTPEPVPQPPAARKTARAAATDSEKPVSFVIQEHHARRLHWDFRLE
HEGVLVSWAVPKGPPLQRGIQRLAVMTEDHPLDYGTFEGTIPKGQYGAGEVSIWDAGECT
IEKWRDGKEIIAVLSGREDGGLGGIPRRFVLIQARGMGDQDNWLLQLTKEQPSEDSTVPE
DIPDSSLLDEVPKPMLASSGVPEDIIEGDDWCFEMKWDGYRALAKVENGKVKLLSRNGND
MTEDFPELQELAVLAPEGAIVDGEIVALDGSARPSFSLLQQRISHRRKNRLRQAQAIKLN
FMLFDALQLPRSKGGKPENLIGEQYVDRRKYLEHAVSDGQYIKVPPAHTGPTLKAALKTS
LELGLEGVLAKECTGDYEPGRRSGSWVKIKHLLDQEALVIGWTKGQGNRASSIGSLLLAV
PAGDELEFIGRVGTGFSDLQLKEIRERLEKIARKTPPVKHIPAQFQRDAHWVTPKYVAEV
RYSELTKDGRLRHPVWRGWRDDKEPAEVRWEHPGSLMK
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcagggaacaaacggtcaccgttgatggccgcaccctgaaggtcagcaatctg
gataaggtgctatacccggaaaccgggacgaccaagggcgaagtcatcgactacctgcag
cgggtggccccggcgctgctgccgcatgcggcatggcgcccggcaaccagaaaacgctgg
gtggacggggtcggcacggcacggaacccgggaaccgtgttcttccgcaaggatctggag
gattcggccccaagctggattcccagagcccgtctggagcacaaaacccattccaataca
tatcccctggccaacgatgcggcagtactggcatggttcgggcaagtcgcagcgttggag
atccacgttccccaatggcgtttcaatgcgagcctggaacaacagcatcccgaccggctc
gtgctggatctggatcccggtcccggcgcaggcttggcccagtgcgccgaagtggctttg
ctatgccgcgaaatccttgagggcatggacctgcggccttttccggtgacctccggatcc
aaggggatccacctttacgccggtctggacggcacggcaacctccgaccaggtcaatgag
gtggccaaggaactcgccgcctcgctagaacgcaagcacccccggcttgtggtggcaaat
atgaagaaatccctgcgcgagaacaaggtgctggtggattggagccagaataacgccgcg
aaaaccacggtatgcccgtattcgctgcgcggacgttcgcgtcccatggtggccgcgcct
cgctcatgggaagaaatcgagtcccccggcctggagcacctggacttccacgaagtattg
gaccggctgtccgacggccttgatcccctggcggccctggcgcctctggcggaacaggga
acagaccggctcgcggtctaccgctccaagcgcgatgcaaagctcactcctgaacccgtg
ccacaaccgcccgcggcccggaaaaccgcgcgggctgcggctacggattcggaaaaaccc
gtgtctttcgtgatccaggagcaccatgcccgcaggctgcactgggatttcaggctggag
cacgagggggtcctggtctcctgggccgtcccgaaggggcccccgctccagagggggatc
cagcggctggctgtgatgaccgaagaccatcccttggactacggaaccttcgaaggaacg
attcccaagggccagtatggcgccggagaggtgtcgatctgggatgccggtgaatgcacc
attgagaaatggcgggatggcaaggagatcatcgcggtgctgtccggacgcgaagacgga
gggctcggcggcattccgcgccgcttcgtgctgatccaggctcgcggcatgggagaccag
gacaattggcttctgcagctcaccaaggagcagccttccgaggattcgacggttccggaa
gacatccctgattccagcctgctggacgaggttcccaagcccatgctggccagctccggg
gtgccggaggacatcatcgaaggcgacgactggtgcttcgaaatgaaatgggacgggtac
cgcgccctggccaaggtcgagaacgggaaggtgaaactgctcagccgcaacggcaacgac
atgaccgaagattttcccgagctacaggaacttgcggtgcttgcacccgagggcgcgatc
gtggacggcgaaatcgtcgccctggacggttcggcccgcccgagcttttccctgttgcag
cagcgcatctcgcatcggcgcaagaaccggctccggcaagcgcaggccattaagctcaac
ttcatgcttttcgatgccctgcagcttccccggagcaagggcggaaagcccgagaacctg
atcggcgaacaatatgtggatcgccgcaaataccttgaacacgcggtctccgacggacag
tacatcaaggtacctcctgctcataccggccccaccttgaaggcggcgttgaagacaagc
ctcgagctgggattggaaggggtgctggccaaggaatgcaccggcgactatgaaccgggc
cggcgcagcggcagctgggtgaagatcaagcacctgctggatcaggaggccctggttatc
ggatggaccaagggacagggaaaccgcgcgtcaagtatcggctcgctgctgctggccgtc
cccgccggcgatgagttggagttcatcggtcgggtcggcacggggttctcggatctgcag
ttgaaggagatccgcgaacgtctggagaagatcgcgcgcaagaccccaccggtcaagcac
atcccggcgcagttccagcgcgatgcgcactgggtgacccctaaatacgtggcggaggtc
cgttacagcgaactgacaaaggacgggcggctgcggcatccggtctggcgcggttggcga
gatgacaaggagcccgctgaggtgcgctgggaacaccccggcagcctcatgaagtaa

DBGET integrated database retrieval system