KEGG   Arthrobacter sp. PAMC 25486: ART_0099Help
Entry
ART_0099          CDS       T03487                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
arm  Arthrobacter sp. PAMC 25486
Brite
KEGG Orthology (KO) [BR:arm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:arm01001]
    ART_0099
Enzymes [BR:arm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ART_0099
Protein kinases [BR:arm01001]
 Serine/threonine kinases: Other
  Bacterial family
   ART_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal RIO1
Motif
Other DBs
NCBI-ProteinID: AIX99697
UniProt: A0A0A1CS44
LinkDB All DBs
Position
complement(106105..108189)
Genome map
AA seq 694 aa AA seqDB search
MQEVSADPLIGSTVDGRYLVLSKVADGGMSTVYRAKDLRLGRNIALKILPASLANDKAFI
AALSSEAASAASLSHPHVVQIHDHAVSPEHAYLVYEFIDGHTLRTVIDQQGPLSPRHALD
LLDPVVEGLAAAHNAGIVHRDVKPENVLISRQGWVKIGDFGLSHAVNAANHTGELLGTVH
YLAPELALRQGSDARSDIYSAGIMLYELLTGRKPFHGNQIAVATAQVHEEVPAPSLLVPG
LPAVMDELVRYMTEKDPDHRPADGAALLEDLRHIRQTLSPAELDFGAPAAAPPQAANPGH
FTEVISVQDATSVISAPTFPTSVLPLPASLYPDGMVQDRDDGGPGATAPIAGTLVPASAD
EQPAFRLSKRQAASLAKADKREQVRVASTPRTTLGPAHPRRRALLWTALVVFLVVLAATA
GWFLGFGPGALAVVPDVHNKTIPQATELLRTAGFEQLPTSEIFDEKVAEGFIVATDPTAG
ESVRKFNSITLLVSRGPVLYPVPQLVGTALAAATTALTDGSLAVGDVSEHYDEKVLAGVV
LSQDPAAGKEFRAGTTVNLVVSKGPKPVPVPAVTGLAEADAVAALQAVGLVAAVAPEQQN
SVSVPAGAVLAQSPESGDLKAGDTVTLTLSMGPKMIDVPSMVGKQVGAATSELKALGFDV
EVKNLLGGFFGTVRFQTPNGGQAPEGSTIVLQVI
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagaagtctccgctgacccgctgatcgggtccactgtcgatggccgctacctggtg
ttgtccaaggtggcggatggtggcatgtccacggtctaccgcgccaaggacctgcggctt
gggcggaacatcgcgttgaagatcctgcccgcgagcctggccaatgacaaggcgttcatt
gcggcgctcagcagcgaggcagccagtgccgccagcctgtcgcacccccacgtggtgcag
atccacgaccatgcggtcagccccgagcatgcgtacctggtctatgaattcattgacggc
cacaccctgcgcacggtcattgatcagcagggtccgttgagcccccgtcacgcccttgac
ctgctggatcccgttgtcgaggggctggccgccgcccacaacgcggggattgtgcaccgg
gacgtcaagcccgagaacgtgctaatctcccgtcagggctgggtcaagatcggtgatttt
ggcttgtcgcacgccgtcaacgccgccaaccataccggcgagttgctgggcaccgtccac
taccttgcccccgaattggccctgcgccagggcagtgatgcgcgcagtgacatttattcg
gccggcatcatgctctatgagctgctgacgggccgcaagcccttccacggcaaccagatc
gccgtcgccacggcccaggtccatgaggaggtcccggccccgtccctgctggttccgggc
ctgcccgccgtcatggatgagctggtccgctacatgaccgagaaggatccggaccatcgc
cctgccgacggcgccgcgctgctggaggatttgcgccacatccgccaaaccctgagcccc
gccgaactggattttggcgcccccgccgccgctcccccacaggccgcaaatcccggccac
ttcacggaagtcatctccgtccaggacgccacgagtgtcatctccgcccccacttttccc
acttcggtgctccccctgcccgccagtctgtatcccgatgggatggtgcaggacagggac
gacggcggacccggcgccaccgcgcccatcgccggcaccctggtccccgcctcggcagac
gagcagccggcgtttaggctgtccaagcgccaggctgccagtctggccaaggccgacaaa
agggaacaggtcagggtggcgtccaccccgcggacgacgttgggacctgcccatccccgc
cgccgcgcgctgctgtggacggcgctcgtggtgttccttgtcgtgctcgccgcaacggcc
ggctggttcctgggctttggccctggcgccctggctgtcgtccctgacgtgcacaacaaa
accatcccgcaggcaactgagttgctccgaacggccggttttgaacaactccccacgtcc
gagatctttgacgaaaaggtagcggaaggtttcatcgtcgccaccgaccccacggctggg
gaatcggtgcgcaaattcaactcaattaccttgctggtctcccgcggaccggtgctttat
cctgtgccgcaactggtgggcacagcccttgccgccgcaacgaccgccctcacggacggc
agcctggctgtgggagacgtgagcgagcattacgacgaaaaggtgctggccggcgtcgtg
cttagccaggatccggcggcgggcaaggagttccgtgccggaaccacggtcaacctggtg
gtgtcgaaggggcccaagccggtgcccgtccccgctgtgacaggcctggccgaggccgac
gccgttgccgcactgcaggcagttggcctggtcgccgctgttgccccggagcagcagaac
agtgtgagcgtgccggccggtgctgtgctggcgcagagccccgaatcgggtgacttgaag
gccggggacaccgtcaccctgaccctgtccatgggcccgaagatgatcgatgtgccaagc
atggtgggcaagcaggtcggcgccgccacctcagaattgaaggcgctgggctttgatgtc
gaggtgaagaacctgttgggtggcttcttcggcaccgtccgcttccagacgcccaatggc
ggacaggcccccgaaggttccacgatcgtcctgcaggtcatctag

DBGET integrated database retrieval system