KEGG   Arthrobacter sp. PAMC 25486: ART_0963Help
Entry
ART_0963          CDS       T03487                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
arm01100  Metabolic pathways
arm01110  Biosynthesis of secondary metabolites
arm01130  Biosynthesis of antibiotics
arm01230  Biosynthesis of amino acids
Module
arm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:arm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ART_0963
Enzymes [BR:arm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ART_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_24 AAA_16 AAA_33 tRNA_m1G_MT AAA Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AIY00562
UniProt: A0A0A1CTG4
LinkDB All DBs
Position
complement(957423..958001)
Genome map
AA seq 192 aa AA seqDB search
MTTGKDSAGAPDFTPHRPIVVIGPMAVGKSVIGAELARVLGIDFFDSDQKIVAKHGPVPG
IFAAKGEHHFRQLEARAIADVLDAAKPKAVVLSLGGGAVLDSGTQQLLARTTVVFLSAEV
DTVKERITRNTGRPLLAADPVATWQRLAAARGPVYARLADITLDVSKSNVPQLVERLIRL
LADESRKENSAS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgggcaaggattcggctggggcgccggatttcacaccccaccggcccatcgtc
gtgatcggccccatggcagtgggcaagtctgtcatcggcgcggaacttgcccgcgtgctg
ggcattgacttcttcgattcggaccagaagatcgtggccaagcacgggcccgtgccgggc
atttttgccgccaagggcgagcaccacttccggcagttggaggcccgtgccattgccgac
gtgctcgatgcggccaagcccaaagccgtggtgctgtccctgggcggcggtgccgtgctc
gactcgggcacccagcagctgctggcccgcaccacagttgtcttcctgagcgccgaagtt
gataccgtgaaggaacgcatcacccgaaacaccggccgcccgctcctggcggcagatccc
gtggcgacgtggcagcgcctggctgcagcccgcggccccgtttacgcccgcctcgcagac
atcacactggacgtcagcaagtcaaatgttccgcagcttgtagagcggctgatccgcctg
ctggccgacgaatcaaggaaagagaattccgcatcgtga

DBGET integrated database retrieval system