KEGG   Arthrobacter sp. PAMC 25486: ART_1112Help
Entry
ART_1112          CDS       T03487                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm00250  Alanine, aspartate and glutamate metabolism
arm00410  beta-Alanine metabolism
arm00430  Taurine and hypotaurine metabolism
arm00650  Butanoate metabolism
arm01100  Metabolic pathways
arm01110  Biosynthesis of secondary metabolites
arm01120  Microbial metabolism in diverse environments
arm02024  Quorum sensing
Module
arm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:arm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ART_1112
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ART_1112
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ART_1112
   00430 Taurine and hypotaurine metabolism
    ART_1112
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ART_1112
Enzymes [BR:arm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ART_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIY00711
UniProt: A0A0A1CZB0
LinkDB All DBs
Position
complement(1114929..1116296)
Genome map
AA seq 455 aa AA seqDB search
MSLHSQHSDRDVTIAGSAFDSGLDAIPRHTLPQGTQDADAAMRFVRDELMLDGNARQNLA
TFVTTWMEPQASALIQASLEKNIIDKDEYPQSAEIERRCVNILANLWHAPEPTGEADAVG
CSTTGSSEAAMLAGMALKWRWRARRETAGLDASRPNLVMGANVQVCWEKFARYWDVEARL
IPLDGATHLTADQAAAACDENTIGVVAVLGSTFDGSYEPVAEIAAALDALAAATGLDVPL
HVDAASGGFIAPFLDPDLLWDFRLDRVKSINSSGHKYGLVYPGVGWVVWRSSEDLPAELI
FSVDYLGGSMPTFALNFSRPAAQVIAQYYTLVRYGFDGYRRIQQRSRDIAGVLASGVEAV
GPFTLLSRGDELPVLAFKLTTPDGWSVYDLSHELRSFGWIVPAYPMPEGMADVDVLRVVV
RNGFTFDLAGMFLADLAKSVQRLAGRQPDRVAFHH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcacagccagcacagcgaccgtgatgtaacgattgccgggagcgcctttgat
tcgggcctcgatgcgatccccaggcacacactgccgcagggcacgcaggatgcggatgcg
gccatgcgcttcgtccgggacgagctcatgcttgatggcaatgcacggcaaaacctggcc
acctttgtcaccacctggatggagccgcaggcgtcggccttgattcaggcgtccctggaa
aagaacatcatcgacaaggacgaatacccgcagtcggccgagattgagcggcgctgcgtg
aatattctggcaaacctgtggcatgcccctgaacccacaggcgaggcggacgccgtcgga
tgttccacgaccgggtcatcggaggcggcgatgctcgcggggatggcgctgaaatggcgg
tggcgtgcgcgccgggagaccgccgggctcgatgccagcaggcccaacctggtcatgggt
gccaacgtccaggtgtgctgggaaaagttcgcccgctactgggatgtggaggcccggctg
atcccgctcgacggcgcaacccacctgaccgccgaccaagccgctgccgcgtgcgatgaa
aacaccatcggcgtggtcgcggtgctgggctccacctttgacgggtcctacgaacccgtg
gccgagattgccgccgccctcgatgcgctcgcagcagccaccggactggacgtgccactg
cacgtggacgctgcctcaggcgggttcattgctccgttcctggatccggacctgctgtgg
gatttcaggctcgaccgggtgaaatccatcaactcctccggacacaagtacgggctcgtc
tatcccggtgttggctgggtcgtgtggcgcagttccgaggacctgccagcggagctgatc
tttagcgtcgactacctgggcggctccatgcccacctttgcgctgaatttttcgcgcccg
gctgcccaagtcatcgcccagtattacacgctggtgcgctacgggttcgacggctaccgg
cgcatccagcagcgctcccgcgacattgcgggcgtccttgccagcggagtggaggcggtg
ggcccgttcacgctgctcagccgcggcgatgagcttccggtcctcgcctttaaactcacg
acgccggacggctggtcggtctatgacctctcgcatgagctgcgcagctttggctggata
gtgcctgcgtaccccatgcctgaagggatggctgatgttgatgtgctgcgcgtggtggtg
cgcaacggcttcacctttgatttggccggaatgtttctggcggacctggccaagtcggtg
cagcgtttggcggggcgtcaaccggaccgggtggcgttccaccactga

DBGET integrated database retrieval system