KEGG   Arthrobacter sp. PAMC 25486: ART_2153Help
Entry
ART_2153          CDS       T03487                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm00010  Glycolysis / Gluconeogenesis
arm00030  Pentose phosphate pathway
arm00051  Fructose and mannose metabolism
arm00052  Galactose metabolism
arm00680  Methane metabolism
arm01100  Metabolic pathways
arm01110  Biosynthesis of secondary metabolites
arm01120  Microbial metabolism in diverse environments
arm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ART_2153
   00030 Pentose phosphate pathway
    ART_2153
   00051 Fructose and mannose metabolism
    ART_2153
   00052 Galactose metabolism
    ART_2153
  09102 Energy metabolism
   00680 Methane metabolism
    ART_2153
Enzymes [BR:arm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ART_2153
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ART_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AIY01752
UniProt: A0A0A1CWZ2
LinkDB All DBs
Position
2224085..2225110
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGIVLKGIKSYGHEFVGFRDGWRGVVEGDVMDLPRQMVRGI
SKQGGTILGTSRTNPFEGNGGPEVIKAHMERLGVDALIAIGGEGTLAAARRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMATGAHAVLIPEQNTSMDQIVEWVQEAHDRGRAPLVVVAEGFVPDHQDSAHSERGLDTF
GRPRLGGISEQLAPEIEARTGIETRATILGHIQRGGVPSSFDRVLATRLGMAAVDSVVEG
RWGTMVSLKGTEIEHVPFEAALGNLKTVPQHRYDEAAILFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagattggaattctcaccagcggcggagactgccctggcctgaacgcagtgatccgt
ggcatcgtactcaagggcatcaagagctacggccatgaatttgttggttttcgagacggt
tggcgcggcgtggttgagggcgatgtcatggacctgccccgccagatggtccgcggcatc
tccaagcagggcggcaccatcttgggcacctcccgcaccaacccctttgaaggcaatggc
ggccccgaggtcatcaaggcacacatggagcgcctcggcgtcgacgccctgatcgctatc
ggcggcgaaggcacactggccgccgcacgccggctcaccgacgccggactgaaaattgtg
ggcgtgcccaagaccgttgacaacgaccttgacgccaccgactacaccttcggtttcgac
actgccgtgcagattgccaccgaggcgatcgaccgcctgcgcaccacaggtgaatcccac
caccgctgcatgattgcagaggtcatgggccgccacgttggctggattgccctgcatgca
ggcatggccacgggcgcgcacgctgtgctgatcccggagcagaacaccagcatggaccag
atcgttgaatgggtgcaggaagcccacgaccgcggccgcgcacccctcgtggttgttgcc
gagggcttcgtccccgaccaccaggattcggcacactccgagcgcggcctggacaccttt
ggccgcccccgcctgggcggcatcagcgagcagctggcccctgagatcgaggcccgcaca
ggcatcgaaacccgtgccaccattctcggccacatccagcgtggcggcgttccctcaagc
tttgaccgcgtactggccacccggctgggcatggccgccgtcgattccgtcgtggaaggg
cgctggggcaccatggtttcgctcaagggcacagagattgagcatgtccccttcgaagcg
gccctcggcaacttgaagactgttccgcagcaccgctacgacgaagccgccattttgttc
ggctaa

DBGET integrated database retrieval system