KEGG   Arthrobacter sp. PAMC 25486: ART_2421Help
Entry
ART_2421          CDS       T03487                                 

Definition
(GenBank) putative exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm00511  Other glycan degradation
arm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ART_2421
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ART_2421
Enzymes [BR:arm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ART_2421
Bacterial toxins [BR:arm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ART_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 NPCBM_assoc BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AIY02020
UniProt: A0A0A1CXU4
LinkDB All DBs
Position
complement(2510466..2513210)
Genome map
AA seq 914 aa AA seqDB search
MKSTDFQRRWKRPRTVAIAGALTAGLLASMVAPAVADQATASTAAVGSYEEQILAKNGDN
AIDPVLGANYRIPALAHLGDGIVLASYDGRPFGGDSPQPNSILQRRSIDNGQTWGEPTYV
ARGQMPAGDKLVYGFSDPSYVVDDVTGDVFNFFVYSKDVSFQEGGFGNDDADRRITSAAV
AVSKDQGLTWSMDPAHMPVLPPVDYTADSEFASYAGPLITDVVKPVGDSHNIGGVQGVFA
SSGQGIQLKYGAYAGRLIQQFTGKVKQADGHIQYQAYSVYSDDHGATWHRGEFVGTGMDE
NKTVELSNGDVMLNSRASSGGNGGRKVAISTDGGTSYGDVTVDTLLSDPINNASIARMFP
DAAEGSAEAKMLLFSNANSNSGRQNGTIRYSCNDGATWSAGKQFKAGAMSYSTVTALGDG
TFGVFYEGDHNTMTFGKFNAEWLDIECGVELSAKPLTGDNGVTVEAELTLANGSQNAIAG
AKASFAQQNAWNFGVADFPDVAAGASATVKVPVTIPASAKAGTINVTAKVNYGTREFSVG
VPVTITGGAEAMLGLDVVGSRTDKDRDLDAEPYSVGEQVPYQFEVTSLGNVSSNVAPISG
NFNPFLPPAGGNCRWKDLSMWANYTCGTPRHTVTAEDLADGFFVPQTTWEVSSTGMDTQN
YDFTGDEVDLLKRNPSLALTIADGTVTDVDGDGFASIGDIVRYEVSATNDGNVRLTGLSG
IAAIATADMGDTGLAVGQREVGTFDHVLDAEDIAAASVSGVQVTASAFNGILEATAVVEA
AGRDLEVAPAEPETPGDTPGETPGETPGETPGETPGGTPGNGQLPGENPGATPTDKPIET
PGAVVTPTDKPGWTPGATQPPAPVESALSTEAQTNVKEVLATTGTNATMLVLGGFLLLGL
GALVVVRTSRRTRH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaccgacttccaacgccgatggaagcgaccccggacggtcgccatcgccggg
gcactgactgcaggtctgctggccagcatggtcgcaccggccgttgccgatcaggcgact
gcttcgaccgcagccgttggcagctatgaagaacagattctcgccaagaacggcgacaac
gccatcgaccccgtgctgggcgccaactaccgcatcccggcattggcccacctaggtgat
ggcattgtgctggcctcctacgacggccggcccttcggcggcgactcgccccagccgaac
tccatcctccagcgtcgcagcattgacaacggacaaacgtggggcgagcccacctacgtt
gcccgtggccagatgcccgccggcgacaagctggtctatggcttcagcgacccgagctac
gttgtcgatgacgtcaccggggacgtcttcaacttcttcgtctactccaaggacgtcagc
ttccaggaaggcggcttcggcaacgacgatgccgaccgcaggatcaccagtgccgccgtc
gcagtgtccaaggaccagggtctgacgtggtccatggaccctgcccacatgcccgtgctt
cccccggttgactacactgccgattctgagtttgcctcctatgccggcccgttgatcacc
gatgtggtcaagcccgtcggagactcccacaacattggcggcgtccagggtgtctttgcg
tcatcaggccagggcattcagctcaaatacggtgcgtacgcgggccgcctcatccagcag
ttcacgggcaaggttaagcaggctgatggtcacatccagtaccaggcctacagcgtctac
tccgatgaccacggcgccacgtggcaccgtggtgaatttgtcggaaccggcatggatgag
aacaagactgttgagctctccaatggcgacgtcatgctgaactcccgcgccagttcgggc
ggaaatggcggccgcaaggttgccatctccacggatggcggcacgagttacggcgacgtc
acggtggacaccttgctgagcgacccgatcaacaacgcctccattgcccgcatgtttccg
gatgctgccgaaggttccgccgaagccaagatgctcctcttctccaacgccaacagcaac
tcgggccgccaaaacggcaccatccgctactcctgcaacgacggcgccacctggagcgcc
ggcaagcagttcaaggccggcgccatgagctactccaccgtgaccgcactcggtgacgga
acctttggtgtgttctacgaaggcgaccacaacaccatgaccttcggcaagttcaacgcc
gaatggctcgatattgaatgcggcgttgagctttctgccaagccgctgaccggcgacaac
ggtgtaacggtcgaggccgagctcacgctcgccaacggcagccagaacgccattgccggt
gcgaaggcgagcttcgcgcagcaaaacgcctggaacttcggcgttgcggatttcccggac
gtggccgccggcgcctccgcaaccgtcaaggttcccgtgacgatcccggccagcgccaaa
gccggcaccatcaatgtcacggccaaggtcaactacggaacccgcgaattcagcgtcggg
gtcccggtaaccatcaccggcggtgccgaggccatgctgggactggacgttgtgggctcc
cgtacggacaaggaccgcgacctcgacgccgaaccgtactccgtgggtgagcaggttccg
tatcagttcgaagtgacgagcctgggcaacgtctcctccaatgttgcgccaatttccggc
aacttcaacccgttcctgccaccggcaggcggcaactgccgctggaaagatctgtcgatg
tgggcgaactacacctgcgggaccccacgtcacacggtcactgccgaggacttggctgac
ggcttcttcgttccccagaccacgtgggaagtcagcagcaccggcatggatacccagaac
tacgacttcaccggtgatgaagttgaccttctcaagcgcaacccttccctggcgctgacc
attgctgatggaaccgttaccgacgtcgacggcgacggctttgccagcattggcgacatc
gtccgctacgaagtgagcgccaccaacgacggcaacgtccgattgaccggtctctcggga
attgccgccattgccactgcagacatgggcgataccggactcgccgtgggccagcgcgag
gtcggcaccttcgaccacgtccttgatgcggaagacatcgcagcggcttccgttagtggt
gtccaggtcaccgcctcggcattcaacggcatcctggaggcaactgcagttgtggaagcc
gcaggacgggatctcgaggttgctccggctgaacctgagacaccgggcgataccccgggc
gagacaccgggtgaaacgccgggcgaaactccgggcgagacgcctggtggaaccccaggc
aacggtcaactcccgggtgaaaatcccggtgctacgccgacggacaagccgatcgaaaca
cccggcgccgtcgtaacaccgacggataagccgggttggacacccggagcaacgcagccg
ccggcacctgtggagagcgccttgtcgactgaggcgcagaccaatgtcaaggaggttctg
gccactacgggcaccaacgcgacaatgctggttctcggcggtttcctgctgctgggtctt
ggtgccctcgtcgttgttcggacgtcgcgccggacgcgtcactag

DBGET integrated database retrieval system