KEGG   Arthrobacter sp. PAMC 25486: ART_3013Help
Entry
ART_3013          CDS       T03487                                 

Definition
(GenBank) histidine kinase
  KO
K07778  two-component system, NarL family, sensor histidine kinase DesK [EC:2.7.13.3]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:arm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ART_3013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:arm01001]
    ART_3013
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:arm02022]
    ART_3013
Enzymes [BR:arm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ART_3013
Protein kinases [BR:arm01001]
 Histidine kinases
  NarL family
   ART_3013
Two-component system [BR:arm02022]
 NarL family
  DesK-DesR (membrane lipid fluidity regulation)
   ART_3013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 PRIMA1
Motif
Other DBs
NCBI-ProteinID: AIY02612
UniProt: A0A0A1CZH0
LinkDB All DBs
Position
complement(3120967..3122280)
Genome map
AA seq 437 aa AA seqDB search
MIQSFRERLRPHSALLSPLPMHFAHGIHDKCHCPKLNPMPTPEIPQPPATLGRSVRTTWT
YTLGSIVFILVVLDAMLLGLAVESFNATYDVVSGLLLVTFLAAVLTQVRYAWFLRAGLGG
GLPRTVWTVALILPAAVVWVLGLFVAADAPLWVLPLWLAVCLLACLLPTWQRMAVLGAGL
AAALLHPFAYALVNGSAYGVPDNPGVRMLLVYAAGMPLVLLSSLWWWRVVVELDRHRLMA
GELAVAQERLRFAADLHDIQGHHLQVIALKSELAERLLPIDVDAARANIHETRLIAKQAL
EETRTLVSGYRETSLENELENAREVLTASGAACELQLTPVPAGPAAHKALAMTVREATTN
ILRHSDATTAAITLAASPGGASLTISNNGAVSPIPGTGTGLLGLRERLEALGGTLETSMD
TGRFELQAWVPTKGTLP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatccttccgcgagcgcctccgcccgcacagtgcgttgttgtcaccgcttccc
atgcactttgcacacggaatccatgacaaatgtcattgccctaaactgaaccccatgccc
acccccgaaatcccgcagcctcccgccaccctcggccgcagcgtgcgcaccacctggacc
tacacgctgggttccattgtgtttatcctcgtggtcctggatgccatgctgctgggcctg
gccgtggagtcctttaatgccacgtacgacgtcgtttccgggcttctccttgtcactttc
cttgccgctgttctcacccaggtccgctacgcctggttcctgcgggcggggttgggcggc
ggactcccccgcacggtgtggacggtggcgctgattctgcccgctgccgtggtttgggtg
ctgggcctgttcgtggctgccgatgccccgctgtgggtgctcccgctctggctcgcagtc
tgcctgctcgcctgcctgctgcccacgtggcagcgcatggcggttctgggtgccggcctc
gccgctgccctgctgcatccttttgcttacgctctcgtcaatggctccgcgtacggcgtg
ccggacaatcccggcgtgcgcatgctcctggtttacgcggcgggcatgcccctggtgctg
ctgagcagcctgtggtggtggcgggttgtggtggaactggaccggcacaggctcatggcg
ggggaactcgccgtcgcacaggaaaggctgcgttttgccgcggacctgcacgacatccag
ggccatcacctgcaggtcattgcgctgaaatccgagctggccgaacggctgctgcccatc
gacgtcgacgccgcacgcgccaacatccacgagacccggctcattgccaagcaggccctc
gaggaaacccgcacgctggtctcgggctaccgcgaaacgtccctggaaaatgagctggag
aatgcccgcgaagtcctcacggcttccggcgccgcgtgtgaactgcagctgacccccgtc
ccggcaggccccgccgcgcacaaggccctggccatgacagtgcgtgaggcaaccaccaat
attctgcggcacagcgacgccacaacggccgccatcacgctggcagcatcgcctggcggg
gcgtccctcaccatcagcaacaacggggccgtttccccaataccgggcactggcaccggc
ctgctcgggctgcgggaacgcctcgaggccctgggtggcacacttgaaacgtccatggac
accggtcgctttgaattgcaggcatgggtccccactaaaggaacactgccatga

DBGET integrated database retrieval system