KEGG   Arthrobacter sp. PAMC 25486: ART_3866Help
Entry
ART_3866          CDS       T03487                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm00020  Citrate cycle (TCA cycle)
arm00480  Glutathione metabolism
arm01100  Metabolic pathways
arm01110  Biosynthesis of secondary metabolites
arm01120  Microbial metabolism in diverse environments
arm01130  Biosynthesis of antibiotics
arm01200  Carbon metabolism
arm01210  2-Oxocarboxylic acid metabolism
arm01230  Biosynthesis of amino acids
Module
arm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
arm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:arm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ART_3866
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ART_3866
Enzymes [BR:arm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ART_3866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CBM39
Motif
Other DBs
NCBI-ProteinID: AIY03465
UniProt: A0A0A1D1X4
LinkDB All DBs
Position
4039918..4042137
Genome map
AA seq 739 aa AA seqDB search
MAKIIYTLTDEAPMLATYSLLPIVEAFASTAGVDVETRDISVSARIIAVFGDYLTEDQRI
DDALAELGALAKSPDANIIKLPNISASIPQLKAAIAELQGQGFALPDYPDDPSTDEEKDV
RARYDKIKGSAVNPVLREGNSDRRAPLSVKNYAKANPHSMGAWSVDSKTNVATMSEGDFR
HNEKSVVIAADDKIKIQFVAADGTTTVLKDSFAVLADEIVDGTVMRAAALDTFLAAQVAR
AKEEGILLSAHLKATMMKVSDPIIFGHVVKAYFPELFANYGDALAAAGLSPANGLASIIN
GLGELPADVRAGVEAAIKKGYEDGPALAMVDSSKGITNLHVPSDVIVDASMPAMIRTSGH
MWGADDQEHDTLAVLPDSSYAGVYQATIEDCRAHGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFELSEAGTVQIVNAAGTVLIEHDVAAGDIWRACQVKDIPVRDWVKLAVTRARASAT
PAIFWLDPTRAHDANIITKVNEYLKDHDTEGLDIRIMSPEDATKFTLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLIAGGGLFETGAGGSAPKHVQQLIKENHLRWD
SLGEFLAIAVSFEHLAVTEGNARAQILADTLDRATGTFLLENKSPKRKVGEIDNRGSHFH
LAKFWAQELAAQTVDADLAAAFKAVAADLTTNEDAIIAELADVQGSPVDLGGYYRPDAAK
VAAIMRPSALLNKAIDTLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaatcatttacaccctgacagacgaagcgcccatgttggccacgtactcactc
cttccgattgttgaggccttcgcctccaccgccggcgtggacgtggaaacccgggacatt
tcagtctcagcccgcatcatcgcagtattcggcgactacctcaccgaagaccagcgcatc
gacgacgcccttgccgaattgggcgccctggccaagagcccggatgcaaacatcatcaag
ttgccgaacatcagcgcctccatcccgcagctgaaggcggccattgccgaacttcagggc
cagggattcgcgcttccggactacccggacgacccctccacggatgaggaaaaggacgtt
cgcgcccgctacgacaagatcaagggcagtgccgtgaacccggtcctgcgcgaaggtaac
tccgaccgccgcgcacccttgtcggtcaagaactacgccaaggccaacccgcacagcatg
ggtgcctggagtgtagactccaagaccaacgtcgccaccatgagcgagggcgacttccgc
cacaacgagaagtcagttgtcatcgcagccgatgacaagatcaagatccagttcgttgcc
gccgatggcaccaccaccgtgctgaaggactccttcgccgtgctggccgatgaaatcgtt
gacggcaccgtcatgcgcgccgctgcgttggatacgttcctggcagcccaggtggcccgt
gccaaggaagagggcatcctgctctcggcccacctgaaggccaccatgatgaaggtctcg
gaccccatcatcttcggccacgtcgtcaaggcctacttcccggaactgttcgccaactac
ggcgacgcactggcagcagccggcctgagcccggccaacggcctggcctccatcatcaac
ggcctgggcgaactgcccgccgatgtgcgtgcaggagttgaagcagccatcaagaagggc
tacgaagacggtccggcactggccatggtcgattccagcaagggcatcaccaacctccac
gtcccctccgacgtgatcgttgacgcgtccatgcccgccatgatccgcacctcgggccat
atgtggggtgccgacgaccaggagcacgacaccctggcagttttgcccgacagcagctac
gccggcgtgtaccaggcaaccattgaggactgccgcgcgcacggcgcctttgatccgacc
accatgggcaccgttcccaacgtcggtttgatggcacaggcggccgaagaatacggcagc
cacgacaagaccttcgagctgtccgaagccggcaccgtccagatcgtcaacgccgcaggc
accgtgctgatcgagcacgacgtcgcagccggggacatctggcgtgcctgccaggtcaag
gacatcccggtccgcgactgggtcaagctggccgtcacccgcgcccgcgcctcagcgacc
cccgccatcttctggctggatccgacccgcgcgcacgacgccaacatcatcacgaaggtc
aacgaatacctcaaggaccacgacaccgagggcctggacatccgcatcatgtcgcccgag
gacgccaccaagttcaccctggagcgcatccgccgcggcgaggacaccatctccgtcacc
ggcaatgtgctccgcgactacctgaccgacctgttcccgatcctggaactgggcaccagc
gccaagatgctctccgtagtgccgctgatcgcaggcggcgggctctttgagaccggcgcc
ggcggctccgcacccaagcacgtgcagcagctaatcaaggaaaaccacctgcgctgggat
tcgctcggcgagttcctggcgattgctgtcagcttcgagcaccttgccgtgaccgagggc
aacgcccgcgcgcagatcctggccgacaccctggaccgcgccactggcacgttcctgctg
gagaacaagtccccgaagcgcaaggttggcgagatcgacaaccgcggcagccacttccac
ctggccaagttctgggcccaggaactggccgcgcagaccgttgacgcggacctggccgca
gcgttcaaggctgtcgcagcggacctgaccaccaacgaggacgcgatcatcgccgaactc
gccgatgtgcagggctcacccgttgacctgggcggctactaccgccccgatgcagcgaag
gtcgcagccattatgcgcccgtcggccctgctgaacaaggccatcgacactctcagctag

DBGET integrated database retrieval system