KEGG   Arthrobacter sp. YN: CGK93_03050Help
Entry
CGK93_03050       CDS       T05171                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00020  Citrate cycle (TCA cycle)
arn00190  Oxidative phosphorylation
arn00650  Butanoate metabolism
arn01100  Metabolic pathways
arn01110  Biosynthesis of secondary metabolites
arn01120  Microbial metabolism in diverse environments
arn01130  Biosynthesis of antibiotics
arn01200  Carbon metabolism
Module
arn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
arn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:arn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGK93_03050
   00650 Butanoate metabolism
    CGK93_03050
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CGK93_03050
Enzymes [BR:arn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CGK93_03050
    1.3.5.4  fumarate reductase (quinol)
     CGK93_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 DAO HI0933_like GIDA Thi4
Motif
Other DBs
NCBI-ProteinID: ASN18794
UniProt: A0A221NFS2
LinkDB All DBs
Position
complement(638076..639824)
Genome map
AA seq 582 aa AA seqDB search
MNLNTNPERLLSTSVLVIGTGGAGLRASIELAQRGVQVLAVGKRRKHDAHTSLAAGGINA
ALGTMDPQDSWQQHAADTLRESYFLADPSIVETVARNAARGIEDLEQWGMPFAREEDGRI
SQRFFGAHKYRRTAYAGDYTGLEIQRTLMRRAAELNVPIIDTVYITRLLVADGTVFGAYG
FDVVDGTPVQIHADAVILAAGGHTRIWRHTSSRRDENTGDSFRLAALAGARIRDAELVQF
HPSGLLEPDDAAGTLVSEAARGEGGILTNALGERFMERYDPERMELSTRDRVALAAFTEV
AEGRGTQKGGVYLDVSHLPRETIMEKLPRVYRTLIDLQMLDITTTKIEIAPTAHYSMGGV
WVAPEDHGTGVNGLYAIGEASSGLHGANRLGGNSLIELLVYGRITGEHVADYVHSRTHLV
RDPAAVGIARGEMQSLLSERGTESARRLQRELRNLMTEHAGVVRTEQGLEQGLEKLTALE
ERAQLVTAHPDIAGFDDLAHAYDLLGSLLAARATLECALERRETRGAHNRADFPMADPSL
QGNFVWSTDEGVRFESLPPAPESFRALAEATADDSVAGKLVE
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcaacaccaatccagaacgactcctgtccacttcggtgctggtgatcggcacc
ggcggcgccggcttgcgcgcctcgattgagctcgcccagcggggcgtgcaggtgcttgcg
gtgggaaagcgtcgcaagcacgacgcccacacgagccttgccgccggtggcatcaacgct
gctttgggcacgatggacccgcaggacagctggcagcagcacgccgccgacaccttgcgg
gagtcctacttcctggccgacccgtccatcgtcgagaccgtggcccgcaacgctgcccgc
ggcatcgaggaccttgaacagtggggtatgccctttgcccgcgaggaagatggacgaatc
tcccagcgcttcttcggcgcgcacaagtatcgccgcacggcctacgccggggactacacc
gggttggagatccagcgcacgctgatgcgccgggcggcagagttgaacgtgcccatcatc
gacaccgtctacatcacccggttgctcgtcgccgacggcaccgtctttggagcctatgga
ttcgacgttgtggacggcacccccgtgcagatccacgccgatgccgtcatccttgccgca
ggcggacatacccgcatctggcggcatacctcttcccgtcgcgatgaaaacaccggggac
tccttccggctggccgccctggccggagcccggatccgcgacgccgagctggttcagttc
cacccgtcagggctgttggagcccgacgacgccgccggcaccttggtctcggaggcagcg
cgaggcgaaggaggcattctcaccaacgccctcggtgagcgcttcatggaacgctacgac
cctgagcgcatggaactttccacccgggaccgggttgcgctggccgccttcaccgaagtc
gccgaaggtcgcggtacccagaagggcggcgtctacctggacgtgtcccacctgccacgg
gaaaccatcatggaaaagctgcctcgggtctaccgcaccctgatcgacctgcagatgctg
gacatcaccaccaccaaaatcgagattgcgcccaccgcccactactcgatgggtggggtc
tgggttgcgcccgaggaccacggaacgggagtcaacggcctctacgcaatcggcgaggca
tcgtccgggctgcacggcgccaaccgtctcggcggcaattcactgattgagctgctcgtt
tacggacgtataaccggcgagcatgtggccgactacgtccattcgcgtacccatctggtc
cgggatcccgccgctgtaggaatagcccgcggggaaatgcagtcactgctcagtgaacgc
ggaacagaatccgcacggcggctgcagcgtgaactacgcaacctcatgaccgaacacgcc
ggggtggtccgcactgaacagggactggaacaaggactcgagaagctgacggccttggag
gagcgcgcccagctggtcaccgcccacccggacatcgccgggttcgatgatctggcccac
gcctacgaccttctcggctccctgctggcagcacgggccaccctcgagtgcgcccttgaa
cgccgcgaaacccgcggcgcccacaaccgtgctgacttcccaatggcagatccctcactc
caggggaactttgtctggtcaacagatgagggcgtcagattcgaaagtctgcctccggct
ccggagtccttccgagcccttgccgaggccaccgcggacgattccgtcgccgggaagctc
gtcgagtaa

DBGET integrated database retrieval system