KEGG   Arthrobacter sp. YN: CGK93_08750Help
Entry
CGK93_08750       CDS       T05171                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
arn  Arthrobacter sp. YN
Brite
KEGG Orthology (KO) [BR:arn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:arn01001]
    CGK93_08750
Enzymes [BR:arn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CGK93_08750
Protein kinases [BR:arn01001]
 Serine/threonine kinases: Other
  Bacterial family
   CGK93_08750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: ASN19760
UniProt: A0A221NIF6
LinkDB All DBs
Position
complement(1938199..1940262)
Genome map
AA seq 687 aa AA seqDB search
MVQEPTQDHLIGTMVDGRYLVRSRLAKGGMSTVYLATDQRLERDVALKVLHPHLANDPTF
LQRLSREAKAAASLSHPHIVGVLDQGEDGHIAYLVMEFVKGHTLRDVLTEQGALAPRLAL
ALIDPVIEGLAAAHNSGLIHRDIKPENVLIADDGRIKVGDFGLARAVSANTSTGALIGTV
AYLAPELVLGQPADARSDIYSAGIMLYEMLTGKQPYAGDSPIQVAYQHVNAVVGRPSDIV
PGLAEDLDELVQWCTATDAENRPVDGTALLAELRHIRTTLTDQQLDHRQGPGPNPYPAAS
AATAPGGGAGSPTEALATTASPTEFISHQSNPTTIMAAGGSALQHSRAAAGGDTDQDLRQ
PGKRELKRLERQQTKDRARAAATPVRPLREGNPRRRGVIWTVVIIILAMLAAAAGWFFGM
GPGSPGTVPDVKNKTVAEAQQLLRTAGFQSEPRDVFDDDILAGLAVGTEPESGAEVRKFQ
SITLFVSKGAQLFPLPELTGGTLDEAKTALNAAEMALGNVTEAFDEKVPAGVVIAQDPAK
GTEVRHGTPVALEVSKGPQPIPVPDVRGKAQDAAVKALQDAGLKAVIAPETVNDKSVPKG
AVVSQTPANGTLIRGESVTLTVSKGPKMVRVPSFIGKQADEAEKELKKLGFKVEINKILG
GFFGTVRDQSPVNTEVPEDSVITLTVV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagaaccaacgcaggaccacctcattgggaccatggtggacggccggtacctg
gtccgttcccgcctcgccaagggcggaatgtccaccgtctacctggccacggaccagcgc
cttgagcgcgacgtggccctcaaagtcctgcacccacacctggcaaacgatcccaccttc
ctgcagcggctgagccgcgaagcaaaagccgccgccagcctttcccacccccatattgtg
ggcgtactggaccaaggcgaagacggacacatcgcctatctggtgatggaattcgtcaag
ggccacaccctccgcgacgtcctcaccgagcaaggcgccctggcaccgaggcttgccctg
gcactgatcgatcctgtcatcgaaggactggccgctgcccataactccggcttgatccac
cgggacatcaaacctgagaacgtcctgatcgccgacgacggccggatcaaagtaggcgat
tttggcctggcccgggcggtctcggccaacaccagcaccggcgccctgatcggcaccgtg
gcttaccttgctcccgaactggttctcgggcaacccgcggatgcccgcagcgatatctac
tcggcgggcatcatgctctacgaaatgctgaccggcaagcagccctacgccggcgactcc
cccatccaggtggcctaccagcacgtcaacgctgtagtgggacgcccctcggacattgtt
cccggactggcggaagaccttgacgaacttgttcagtggtgcacggccacagatgcagag
aacaggcctgtggacggcactgccctcctggccgaactccgccacatccgaaccacgctg
accgaccaacagttggaccaccggcaaggcccgggacccaacccctaccccgcggcgtcc
gcagccaccgcgcccggtggcggcgccggcagtcctacggaagcgctggcaaccacggcg
tcacccacagagttcatcagccaccagagcaacccgaccaccatcatggccgccggtggt
tcggctcttcagcactccagggctgcggcaggcggggatactgaccaggaccttcgccaa
ccgggtaagcgcgagttgaagaggctcgagaggcaacagaccaaagaccgcgcacgcgct
gctgcgacccctgtccgccccctcagggaaggcaatccccgccgccgtggcgtgatctgg
accgtcgtgatcatcatcctggcgatgctcgcggccgcagccgggtggttcttcggcatg
gggccgggctcacccgggaccgtgcccgacgtcaaaaacaagactgttgccgaggcacag
caactcctccgtactgccggcttccaatcggagccacgcgatgttttcgacgacgacatc
ctggccggactcgcggtcggaactgagcccgaatccggcgccgaagtacggaagttccag
tccatcacccttttcgtctccaagggggcccaactcttccccttgcccgaattgaccggc
ggaaccctggacgaggccaagacggcactcaatgccgcggaaatggccttggggaacgtc
accgaagcctttgacgagaaagtacctgccggcgtcgtgattgcccaggacccggccaag
ggcactgaagtacggcacggtacgcctgtggccctggaagtttccaagggtccgcagccg
attcccgtgccggacgtccgcggcaaggcacaggatgccgcagtcaaggccctccaggac
gccgggctcaaagcagtgatcgctccggagaccgtcaatgacaaatcggtccccaagggc
gcggtggtctcccagaccccggccaacggcaccctcatccgaggcgagtccgtgacgctg
accgtgtccaaggggcccaaaatggtgagggtccccagcttcattggcaaacaggcagat
gaggctgagaaagagttgaagaagctgggcttcaaggtggagatcaacaagatcctcggc
ggattcttcggtaccgtccgtgaccaaagccccgtcaataccgaagtgccggaagattcc
gtcattacgctgactgtcgtctag

DBGET integrated database retrieval system