KEGG   Arthrobacter sp. YN: CGK93_11330Help
Entry
CGK93_11330       CDS       T05171                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00040  Pentose and glucuronate interconversions
arn00051  Fructose and mannose metabolism
arn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGK93_11330
   00051 Fructose and mannose metabolism
    CGK93_11330
Enzymes [BR:arn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CGK93_11330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C YdfZ ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: ASN20194
UniProt: A0A221NJS4
LinkDB All DBs
Position
2505560..2506621
Genome map
AA seq 353 aa AA seqDB search
MTTSTTRTPLLGPPELPATMRAAILQRQGEMTMETLPIPHLEADQVLVQVSAVGVCGSDV
HYYEHGRIGDYVVDHPLILGHELAGRIAAVGSSVDPARIGARVAVEPQRPCRTCKQCKAG
RYNLCPEMKFYATPPVDGAFVEYVTIQSDFAYDIPDNVSDEAAALIEPLSVGLWACERAE
IKPGSRVLIAGAGPIGIIAAQAARAFGASEIYITDIAGDRLAFALEHGATHALNAKTDSV
EGLDVDAFIDASGAPQAVRSGIKAVGPAGRVILVGLGADDVELPVSYIQNREIWLSGVFR
YTNTWPLAIQLLADGKVDLDILITGKFGLADSESALKAGKQPGQLKAVVYPGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactacctcaaccacccgaacccctctgctcggcccgcctgaactgccagccaccatg
cgcgccgccatcctgcaacggcagggagagatgacaatggagacgctgcccattccacac
cttgaagcggaccaggtcctggtgcaggtttccgccgtcggagtttgcggaagcgatgtt
cactactacgagcatggccggatcggcgattacgtggtggaccaccctctgatcctcggc
cacgaactcgcggggcggattgccgccgtcggaagttctgtggaccccgctcgcatcggt
gcgagggtcgccgtcgagccccaacgcccgtgccggacctgcaagcagtgcaaggccgga
cgctacaacctctgcccggagatgaagttttacgcgacgccgcccgtggacggggcattt
gtcgaatacgtcaccattcaaagcgacttcgcgtacgacatcccggacaatgtcagcgac
gaggccgcagccctgatcgaacctctctcggtaggactctgggcgtgtgagcgggcagag
atcaagcccggcagccgggtcctgattgccggcgccggtcccatcggcattatcgccgcg
caagccgcacgggccttcggtgcaagcgaaatttacatcacggacatcgccggggaccgc
ctcgcttttgccttggaacacggtgcgacgcacgcgttgaacgcgaagacggacagcgtg
gaagggctcgacgtcgatgcgttcattgacgcttccggcgcacctcaggccgtccgttcc
ggaatcaaggccgtggggccggcaggccgagtgatcctggtggggttgggggcggatgac
gttgaactgcctgtttcttacatccagaaccgcgagatctggctctccggcgtgttccgc
tacaccaacacatggccgctcgccatccagttgctcgctgatggcaaagtagatctggac
atcctgatcaccggaaagttcgggctcgctgactccgagtcagcactcaaagcgggcaag
cagccggggcagctcaaagccgtggtgtacccgggccgatga

DBGET integrated database retrieval system