KEGG   Arthrobacter sp. YN: CGK93_14550Help
Entry
CGK93_14550       CDS       T05171                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00473  D-Alanine metabolism
arn00550  Peptidoglycan biosynthesis
arn01100  Metabolic pathways
arn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGK93_14550
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGK93_14550
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CGK93_14550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arn01011]
    CGK93_14550
Enzymes [BR:arn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CGK93_14550
Peptidoglycan biosynthesis and degradation proteins [BR:arn01011]
 Precursor biosynthesis
  Amino acid ligase
   CGK93_14550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Chal_sti_synt_C
Motif
Other DBs
NCBI-ProteinID: ASN20766
UniProt: A0A221NLS2
LinkDB All DBs
Position
complement(3174440..3175576)
Genome map
AA seq 378 aa AA seqDB search
MVTDHSTPATGRPRVAVLFGGRSSEHAVSCVTAAGVMGAIDKSKYEVIPIGIAKSGQWVL
ASGDTSQWSLSSAALPEVAPSGKTVTLAEVGGEHQLIVTEPNAVPQELGSVDVVFPLLHG
PWGEDGTIQGLLELSDTRYVGAGVLASAVGMDKHFMKVVFESAGLSVGPYIAVTDRQWLT
DAEAVRKRVDKLGFPVFVKPARAGSSMGISKVDSLDGLDAAIEEARRHDLKLVIEAGIVG
REIECAVLQGRGTDAPRTSMPGEIAVAAGEHQFYDFAAKYVEDGAAALSCPADMPEEAIS
RVRELAAVAFDAVGAEGLSRVDFFYTPAGELIINEINTMPGFTPKSMYPQMWAASGLAYG
ELIDELIHLALTRKTGLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtgacagaccactccacccctgcaaccggccgcccccgcgtagcggttctctttggc
ggacgctccagcgaacatgccgtcagctgtgtcaccgcggccggcgtcatgggggccatc
gataagagcaagtacgaggtcattcccatcggcatcgccaaatcaggacaatgggtcctg
gcctcgggcgacaccagtcagtggtccttgagttccgcagcccttcctgaggtggcgccg
tcgggaaagactgtgacgttggccgaagtgggcggtgagcaccaactgatcgtgaccgag
cccaacgccgtgccacaggagctgggatcggtggacgtggtgttcccgctgcttcatggg
ccgtggggcgaggacggaaccatccagggcctcttggaactctccgacacgcgttatgtt
ggcgccggagtcctggcctccgcagtggggatggacaagcacttcatgaaggtcgtgttc
gagtccgcgggcctgagcgttggaccgtacattgcagttacggaccgtcaatggctgacc
gacgccgaggctgtccggaagcgcgtcgacaagctcggtttccccgtgttcgttaagcct
gcccgcgccggttcgtccatgggaatctccaaagtggattccctggatggcttggacgcc
gcgattgaagaagcccgccggcatgacctgaagctggtgatcgaagccgggattgtgggc
cgcgagattgaatgtgccgtcctccagggacggggcaccgacgcgccccgaacgtccatg
cccggtgaaattgcggtggcagcgggggagcaccagttctatgacttcgctgccaagtac
gtcgaagacggtgcggccgctctgagctgcccggccgacatgccggaggaagccatcagc
cgagtgcgtgagctggctgctgtggcttttgatgctgtgggagccgaaggcctcagccgt
gtggactttttctatacccctgccggcgagctgatcatcaatgagatcaacaccatgccg
ggtttcacccccaagagcatgtacccgcaaatgtgggcggcgtcaggtctggcctatggc
gagctgatcgacgaattgatccatctggcgctgacccgtaagaccggcctgcgctga

DBGET integrated database retrieval system